DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Spn53F

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:386 Identity:91/386 - (23%)
Similarity:168/386 - (43%) Gaps:40/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVLLLIATSVLGKFKLNLL------ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSV 68
            |:|:|:..|.....|.:.|      .:|...:..|.:.|...|...:..|.:|.:...:|::|..
  Fly     4 LLLILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKA 68

  Fly    69 LDL-PVDVTEMAKKYERIMS-NFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQ 131
            :.. ...::|...|.::|.: :.:|....:.....||.:..::..:|...|:.|   ||:     
  Fly    69 MHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHT---EGR----- 125

  Fly   132 RKASNSISFSIHRKSHKGMRTI-SNDHNLQI-----------NESAVLVNTVYYSGAWKTRFSKK 184
               :.:|:|:  |:....:.|. |::...||           |...:|||.::::.:|:..|:.:
  Fly   126 ---ARNIAFA--REQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPE 185

  Fly   185 DTKLKVFHGDHNKKVYVRMMSHVGRFR--IADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIE 247
            .|..:.|..:..|.|.:.||....:|.  |..:.....:.:||.:.||.|::..|.....|::::
  Fly   186 ATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQ 250

  Fly   248 KILR-----TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK 307
            ..|:     :::.:|...:|.|.:|||||....||..:.:|:||..||..:...|.||...|..:
  Fly   251 MKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFR 315

  Fly   308 INHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRV 368
            |:.|:|....|..|:|..|........|:.........|....||.|.|.|..::||.|.|
  Fly   316 IDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFAGHV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 86/372 (23%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 84/363 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.