DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb9

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:373 Identity:99/373 - (26%)
Similarity:182/373 - (48%) Gaps:37/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYER 84
            |.|.::||:::.....| |...||:.|...::|:|:||||.|..::...|.|..: .::.:.::.
  Rat    31 GTFAIHLLKMLCQSNPSENVCYSPVSISSALAMVLLGAKGQTQVQISQALGLNKE-KDLHQGFQL 94

  Fly    85 IMSNFQKHN---GLRFTNWLYVNETYEV--------RQDYNTLMKSTFMAEGKDPLSQRKASNSI 138
            ::||..|..   .||..|.|:.::|.|:        .:.||:.|:....||..:  ..||..|: 
  Rat    95 LLSNLNKPERKYSLRVANRLFADKTCELLPTYKESCLRFYNSEMEQLSFAEAAE--ESRKHINT- 156

  Fly   139 SFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRM 203
              .:.:::...:..:.:..::......||||.:|:.|.|...|:|:.|....|..:.|:|..|:|
  Rat   157 --WVSKQTEGKIPELLSGGSVDSETRLVLVNALYFKGRWHQPFNKEYTVDMPFKINKNEKRLVQM 219

  Fly   204 MSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR-------TLSESLVE 259
            |.....:.:|  .....|::.||::..:||.::.||.::..||.:|..|.       |..:.:..
  Rat   220 MCCEDTYNLAHVKEVQAQVLMMPYEGMELSFVVLLPDNDGDLSKVESNLTFEKLTAWTNPDFMKN 284

  Fly   260 NNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKINHVVHKSFIEINERG 323
            .||.|.|||||::...::....::|||..:|... :|||. ::......::.:||||.:|:||.|
  Rat   285 TNVEVFLPKFKLQEDYDMESVFQRLGIVDVFQEAKADLSA-MSPERNLCVSKIVHKSLVEVNEEG 348

  Fly   324 ASTGEASDHAESIQKKTRAS--TSFKVNRPFVFLIRDKHT--VYFRGR 367
            .....||    ::.:...|:  .:|..:.||:|.|:...|  :.|.||
  Rat   349 TEAAAAS----AVIEYCCAAFVPTFCADHPFLFFIKHNKTNSILFCGR 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 98/372 (26%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 99/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.