DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Spn31A

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:368 Identity:97/368 - (26%)
Similarity:157/368 - (42%) Gaps:47/368 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIMSNF---------- 89
            ||.|.:.|||.:|..:|::.:|:.|.|||||:..|.|.......||     |:||          
  Fly    27 AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAK-----MANFYAAELGNITT 86

  Fly    90 QKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMA-------EGKDPLSQRKASNSISFSIHRKSH 147
            .....|:..|.|.::....|..|:..:.::.|.|       |..:.| :|..|..|..|:...|.
  Fly    87 DADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKL-RRHISEQILASVGGGSW 150

  Fly   148 KGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFH-GDHNKKVYV----RMMSHV 207
            |.:.......    ..:.:|:........|...||...|.|..|| |...|.|.:    .|....
  Fly   151 KDIHVAGGSS----ANTLLLLLAANLQSKWFLPFSAYRTGLYEFHSGSQVKSVPMLFDDDMFVKF 211

  Fly   208 GRFRIADHSYGQIIEMPFDNS-DLSMIIGLPLHNTYLSSIEKILRTLSESLVENNVHVE-----L 266
            ...|..|   .:.||:|:::: :|||::.||.....|..:||.|..|....::..:.:|     |
  Fly   212 AELRDLD---ARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLL 273

  Fly   267 PKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTG---- 327
            |||.|.::..|.:.||:||...||:.:::...|..: ....|..|:.|..|.:||.|:.:|    
  Fly   274 PKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHAS-ANLPIADVLQKLRINLNESGSGSGPELP 337

  Fly   328 -EASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRVV 369
             .|:::...:...:.....|:.:.||.|.||.::..|..|.||
  Fly   338 KNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHVV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 95/365 (26%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 95/365 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.