DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Spn28Dc

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:444 Identity:106/444 - (23%)
Similarity:187/444 - (42%) Gaps:104/444 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMA 79
            ||.|||....:....|...|.:   |.|||.|...::::|:||||.:.|||.:|.|:| |.:.:.
  Fly   108 IANSVLNFANILGQHLANGKTQ---IYSPLSIVHSLALLLLGAKGRSYEELSTVFDIP-DTSRLH 168

  Fly    80 KKYERIMSNFQKHN------GLRFTNW-------------------------LYVNETYEVRQDY 113
            :::..::.:.|:..      |...|:|                         |:....|.:..||
  Fly   169 EQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDY 233

  Fly   114 NTLMKSTFMA-------EGKDPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESA--VLVN 169
            ..::...:.:       || .|.:.|...|:. .:.|.|:|     |.|.....|.::.  :|.|
  Fly   234 RRVIVEVYASDLQIQDFEG-SPATARYNINAY-VAQHTKNH-----IENIIASDIPQTTRMILAN 291

  Fly   170 TVYYSGAWKTRFSKKDTKLKVFH--GDHNKKVY-VRMMSHVGRFRI-ADHSYG-QIIEMPFDNSD 229
            .:|:...|:|.|.:..|:...|:  |:..:.|. |:||:..|.:.. .||..| :||.:|:..:.
  Fly   292 ALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNL 356

  Fly   230 LSMIIGLPLHNTYLSSIEKIL---RTLSESLVENNVH--------VELPKFKIKYQTELVESLKK 283
            .:|.|..|    :.||:.:::   :.|:...:|:.:.        |..||..:.....|...:::
  Fly   357 STMYIIQP----FKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQR 417

  Fly   284 LGIHLIFSNT-SDLSGLLTN----------------------GTGAK-----INHVVHKSFIEIN 320
            :|:..|||.. :|||.:.||                      |||..     ::.:|||....:|
  Fly   418 MGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVN 482

  Fly   321 ERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRVVRLP 372
            |:|.   ||:..:.:..||:.....|:.:.||:.|:|...|  |.|.|.:...|
  Fly   483 EQGT---EAAASSVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEPP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 100/431 (23%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 102/433 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.