DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpinb1l4

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_956235.2 Gene:serpinb1l4 / 335229 ZFINID:ZDB-GENE-030131-7169 Length:433 Species:Danio rerio


Alignment Length:424 Identity:105/424 - (24%)
Similarity:186/424 - (43%) Gaps:82/424 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNLLELVM-DKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVL---------------- 69
            :|.|||.:.:. ..|..|...||:.|...::|:.:||||.||:::..||                
Zfish    10 QFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNPPKPGGATPTPA 74

  Fly    70 ---------------------------DLPVDV--------------TEMAKKYERIMSNFQKHN 93
                                       :||.|:              .::...:.::||...|..
Zfish    75 QATQKPKWTCGVKSQHEPQALQQPQKFELPADLKKCPAQPVPGQKAEEQIHSSFNKLMSELNKPG 139

  Fly    94 G---LRFTNWLYVNETYEVRQDYNTLMKSTFMA--EGKDPLSQRKAS-NSISFSIHRKSHKGMRT 152
            .   |...|.||..:||:..:.|.:..|..:.|  |..|..::.:|| .:|:..:.:.:.:.::.
Zfish   140 APYVLSLANRLYGEQTYQFLEKYLSDAKKYYAAGLEKVDFKNKSEASCVNINKWVEKNTQEKIKD 204

  Fly   153 ISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFR--IADH 215
            :.....:......||||.:|:.|.|:.:|.|:.||...|..:.|:...|:||....:|.  :...
Zfish   205 LLPSGAIDAMTRLVLVNAIYFKGNWEKKFPKEATKDGQFKLNKNQTKPVKMMHQKAQFPFVVIPE 269

  Fly   216 SYGQIIEMPFDNSDLSMIIGLPLH-NTYLSSIEKILRTLS-ESLV-------ENNVHVELPKFKI 271
            ...||:|:|:...:|||:|.||.. ....:.::|:.|.|: |.|:       :..|.|.|||||.
Zfish   270 INSQILELPYVGKNLSMLIILPDEIEDATTGLQKLERALTYEKLMQWTKVMRQQEVQVSLPKFKT 334

  Fly   272 KYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAES 335
            :...::...|..:|:..:|. ...:|:| :::.....::.|:||:|:|:||.|.....|:....|
Zfish   335 EQTYDMKSLLVSMGMEDVFDPQKVNLTG-MSSSNDLVLSKVIHKAFVEVNEEGTEAAAATGAVVS 398

  Fly   336 IQKKTRASTSFKVNRPFVFLIR--DKHTVYFRGR 367
            |  :|.|.. |..:.||:|.||  ..:|:.|.||
Zfish   399 I--RTLAQI-FNADHPFLFFIRHNSTNTILFYGR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 105/424 (25%)
serpinb1l4NP_956235.2 SERPIN 4..433 CDD:294093 105/424 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.