DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINA9

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:384 Identity:84/384 - (21%)
Similarity:164/384 - (42%) Gaps:76/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVT-EMAKKYERIMSNFQ--- 90
            ||::....|...||:.:...::|:.:||...|..::...|...:..| |.|     |...||   
Human    59 LVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESA-----IHQGFQHLV 118

  Fly    91 -------KHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAE------GKDPLSQRKASNSISFSI 142
                   |...|:..:.|:|.:..:::.::...:|..:.||      ....::|.:.::.:    
Human   119 HSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHV---- 179

  Fly   143 HRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKK--------- 198
             :|..:| :.:.....|.:..:.||||.:::...|:          |.||.::.:|         
Human   180 -KKKTQG-KVVDIIQGLDLLTAMVLVNHIFFKAKWE----------KPFHPEYTRKNFPFLVGEQ 232

  Fly   199 --VYVRMMSHVGRFRIADHSYGQ-------IIEMPFDNSDLSMIIGLPLHNTYLSSIEKIL--RT 252
              |:|.||....:|     ::|.       :::|.:....::..: ||.... :..:|:.|  ||
Human   233 VTVHVPMMHQKEQF-----AFGVDTELNCFVLQMDYKGDAVAFFV-LPSKGK-MRQLEQALSART 290

  Fly   253 L---SESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHK 314
            |   |.||.:..:.|.:|:|.|.....|...|.|:||..:|...:|.||:....: .:::...||
Human   291 LRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDS-LQVSKATHK 354

  Fly   315 SFIEINERGASTGEASDHAESIQKKTRAS---TSFKVNRPFVFLIRDKHT--VYFRGRV 368
            :.::::|.|.....|:.....::.|...|   .||  ||.|:.:|.:|.|  :.|.|:|
Human   355 AVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSF--NRTFLMMITNKATDGILFLGKV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 83/382 (22%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.