DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpina1l

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001013277.3 Gene:serpina1l / 321195 ZFINID:ZDB-GENE-040721-3 Length:433 Species:Danio rerio


Alignment Length:356 Identity:89/356 - (25%)
Similarity:160/356 - (44%) Gaps:33/356 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKK-YERIM---------S 87
            |....|...||:.|.:.:|::.:||||:|..::.|.|.......|...: ||.::         .
Zfish    86 DAQGKNIFFSPVGISMALSLLAVGAKGSTLSQIYSGLGYSALTPEQVNEGYEHLLHMLGHSQDAM 150

  Fly    88 NFQKHNGLRFTNWLYVNETY--EVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGM 150
            ..:...|:...:...|.:.:  :.:..||:      .|.|.|......|:..|:..|.||:|..:
Zfish   151 QLEAGAGVAIRDGFKVVDQFLKDAQHYYNS------EAFGVDFSKPEIAAAEINKFIARKTHDKI 209

  Fly   151 RTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADH 215
            ..:..|  |..:...:|:|.:|:.|.|:.:|..|.|....|..|.:..|.|.||...||:.|...
Zfish   210 TNMVKD--LDADTVMMLINYMYFRGKWEKQFDAKLTHKADFKVDQDTTVQVDMMKRTGRYDIYQD 272

  Fly   216 SYGQ--IIEMPFDNSDLSMIIGLPLHNTYLSSIEKI----LRTLSESLVENNVHVELPKFKIKYQ 274
            ...|  ::.:|: ..:.||:|.||.........|.|    |:...:.|..::|.:.:|||.|...
Zfish   273 PVNQTTVLMVPY-KGNTSMLIVLPNDGKMKELEESICRHHLKNWHDKLFRSSVDLFMPKFSISAT 336

  Fly   275 TELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKK 339
            ::|.:.|..:|:...|...:|.|| :|.....:::.|:|::.:.::|:|  |..|:.....|...
Zfish   337 SKLDDILMDMGMTDAFDYKADFSG-MTEEVKVRVSRVLHQAVMSVDEKG--TEAAAITTIEIMPM 398

  Fly   340 TRASTSFKVNRPFVFLIRDKHT--VYFRGRV 368
            :...|.. :||||:.||.:..|  :.|.|::
Zfish   399 SLPHTVI-LNRPFLVLIVEDSTMSILFMGKI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 89/354 (25%)
serpina1lNP_001013277.3 alpha-1-antitrypsin_like 69..428 CDD:239011 89/354 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.