DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina1f

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:403 Identity:89/403 - (22%)
Similarity:170/403 - (42%) Gaps:82/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLLLIATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDL---- 71
            |.|.|:...:..||    |:.......|.:.||:.:...|||:.:||||..::.:..:|.|    
  Rat    44 VALTISNISITLFK----EMAQLSVNGNILFSPIRVIAAISMLSLGAKGNESKRILEILRLNKTG 104

  Fly    72 --PVDVTEMAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQ--- 131
              ..::.:..:...|.:...::.:.|:..:.::::      ||...:.|   ..||...|..   
  Rat   105 LPEAEIHKCFRYLLRAIHQPEQLSPLKSGSGVFIH------QDLTPVDK---FVEGVKNLYHSDI 160

  Fly   132 --------RKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKL 188
                    |:|...|:..:..||:|.::.|..  ||:.:....:||.:.::....:.|..:..|.
  Rat   161 VSINFTDCRRAKTQINNYMMTKSNKEIKNIVK--NLENDTYMAVVNYIIWNAKINSDFGCRSVKQ 223

  Fly   189 KVFHGDHNKKVYVRM-----MSHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEK 248
            |.:|.:....:.|.|     ::|:  ||:.|.| ..::......|:.:....:|    .:..::|
  Rat   224 KDYHLEQGMTIKVPMIHIVDLNHL--FRVEDLS-STVLVFTLLASNFTTYFIIP----DIGQMQK 281

  Fly   249 ILRTLS-----ESLVENN---VHVELPKFKIKYQTELVESLKK-LGIHLIFSNTSDLSGLLTNGT 304
            :.:.|:     ....::|   |::|.|:..:. :|..|||:.. |||..:|:|.::.|.:: |.|
  Rat   282 VEQRLTYPHFRRMRRQSNLRMVNLETPELSLS-ETHDVESMMNLLGITYVFNNDANSSAVM-NDT 344

  Fly   305 GAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFK-----------VNRPFVFLIRD 358
            ..|...:|.|..:.|:::|:..|.              ||.||           .||||:..|:|
  Rat   345 LQKSFKMVSKVKLTIDDKGSKPGR--------------STCFKNDGSVDVGYVQFNRPFLIFIKD 395

  Fly   359 --KHTVYFRGRVV 369
              .....|.||||
  Rat   396 PTNDVPLFLGRVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 83/389 (21%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 87/400 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.