DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:391 Identity:117/391 - (29%)
Similarity:186/391 - (47%) Gaps:69/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTA-EELRSVLDLPVD-VTEMAKKYERI 85
            |.|.|...:.:.:.:..|.||..|...::|:.:||||::| ..||.......| |.::..:::.:
  Rat    11 FALELFHTLSESSPTGNIFSPFSISSALAMVFLGAKGSSAPSSLRLAETFHFDSVEDIHSRFQSL 75

  Fly    86 MSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKD--PLSQRKASNSISFSIHRK 145
            .:..:||..   |:..|.||..:||....::   :.||....|.|  |:..:.||......|: |
  Rat    76 NAEMRKHGASHTLKVANRLYGEKTYNFLPEF---LASTQKMYGADLAPVDFQHASEDARKEIN-K 136

  Fly   146 SHKGMRTISNDHNLQ---INESA--VLVNTVYYSGAWKTRF------------SKKDTKLKVFHG 193
            ..||.........|.   :|.:.  ||||.:|:.|.|:.:|            :|||||:     
  Rat   137 WVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGIWQEKFLTRHTTDAPFRLNKKDTKM----- 196

  Fly   194 DHNKKVYVRMMSHVGRFRIADHSYG-------QIIEMPFDNSDLSMIIGLPL----HNTYLSSIE 247
                   |:||....:|     .:|       :::|||:...:|||:|.||.    .:|.|..||
  Rat   197 -------VKMMYQKEKF-----PFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLQKIE 249

  Fly   248 KILR-------TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGT 304
            :.|.       |..|:|.|.:|||.||||||:....|..:|.:||:..:||:: :|||| ::...
  Rat   250 EQLTLEKLYEWTKHENLKEIDVHVNLPKFKIEESYILNSNLGRLGLQDLFSSSKADLSG-MSESR 313

  Fly   305 GAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            ...|:.:|||||:|:||.|.....|:  |..::....:..:|.|:.||:|.||...|  :.|.||
  Rat   314 DIFISKIVHKSFVEVNEEGTEAAAAT--AGLVEYCLVSIEAFIVDHPFLFFIRHNPTANMLFFGR 376

  Fly   368 V 368
            |
  Rat   377 V 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 115/389 (30%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 117/391 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.