DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and RGD1564786

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:403 Identity:106/403 - (26%)
Similarity:191/403 - (47%) Gaps:62/403 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YLVLLLIATSVL-------GKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELR 66
            ::|:|....:::       |.|.:.|.:::.:....|...|...|...:|||||||.||||.::.
  Rat    32 FIVILHSRLTIMDPLLKANGNFAIKLFKVLGEDISKNVFFSLPSISSALSMILMGANGTTASQIC 96

  Fly    67 SVLDLPV-------DVTEMAKKYERIMSNFQKHNG------LRFTNWLYVNETYEVRQDYNTLMK 118
            ..:.|..       ||      ::..:|...|.|.      ||..|.:::.:::|:...:.....
  Rat    97 QAMSLDKCNSIGGGDV------HQHFLSLLTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACH 155

  Fly   119 STFMAEGKD------PLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAW 177
            ..:.||.::      |...|:..|:   .:.:|:...:|.:.....:..|....|||.:|:.|:.
  Rat   156 KLYEAEIEELDFKGAPEQSRQHINT---WVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSL 217

  Fly   178 KTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFR---IADHSYGQIIEMPFDNSDLSMIIGLP-- 237
            :..|:|.||:...|....|:|..|:|||....|:   :.|.| .|::.:||:||.|||...:|  
  Rat   218 EKPFNKADTREMPFKVSMNEKKTVQMMSQKSTFKMTYVKDIS-TQVLTLPFENSILSMYFFVPDS 281

  Fly   238 ------LHN--TYLSSIEKILR-TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIF-SN 292
                  |.|  ||    :|.|. |..:::.|..:.|.||:.|::...::...|:|||:...| .:
  Rat   282 HVAQRKLENELTY----DKFLEWTDEDTMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEED 342

  Fly   293 TSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKV-NRPFVFLI 356
            .:|.|| :::..|..::.||||||:|::|.|.   ||:...:.:..|:..:....: :.||:|.|
  Rat   343 KADFSG-ISSKHGLFLSKVVHKSFVEMSEEGT---EAAAPTDVVTMKSPLTPRCLIADHPFLFSI 403

  Fly   357 RDKHT--VYFRGR 367
            :|..:  :.|.||
  Rat   404 QDTRSKEILFLGR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 103/383 (27%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 104/389 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.