DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPIND1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:407 Identity:105/407 - (25%)
Similarity:187/407 - (45%) Gaps:73/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GNNKIKYLVLLLIATSVLGKFKLNLLELVMDKAES--NFIASPLCIEIGISMILMGAKGTTAEEL 65
            |.::|:.|.:|      ..||..||..::.|:..:  |...:|:.|...:.||.:|.||.|.|::
Human   119 GKSRIQRLNIL------NAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQV 177

  Fly    66 RSVLDLPVDVTEMAKKYE--------RIMSN--FQKHNG--LRFTNWLYVNETYEVRQDYNTLMK 118
            .|:|... |....:.|||        |.:::  |:::.|  ||..|.||:.:.:.:..|:.|.::
Human   178 HSILHFK-DFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVR 241

  Fly   119 STFMAEGK-----DPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWK 178
            ..:.||.:     ||....|.:|.|     .|..||:...:.: |:......:::|.:|:.|:|.
Human   242 EYYFAEAQIADFSDPAFISKTNNHI-----MKLTKGLIKDALE-NIDPATQMMILNCIYFKGSWV 300

  Fly   179 TRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHSY--GQIIEMPFDNSDLSMIIGLPLHNT 241
            .:|..:.|....|..:..:.|.|.||...|.|..|:...  ..|:::.:... :||:|.:|...:
Human   301 NKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGG-ISMLIVVPHKMS 364

  Fly   242 YLSSIE-----KILRTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLT 301
            .:.::|     :::....:|:......|.|||||::....||||||.:||.::|....:::|:  
Human   365 GMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGI-- 427

  Fly   302 NGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRAST-------------SFKVNRPFV 353
            :.....|:...|:..|.:||.|                |:|:|             .|.|:|||:
Human   428 SDQRIAIDLFKHQGTITVNEEG----------------TQATTVTTVGFMPLSTQVRFTVDRPFL 476

  Fly   354 FLIRDKHT--VYFRGRV 368
            |||.:..|  :.|.|||
Human   477 FLIYEHRTSCLLFMGRV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 99/386 (26%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 105/407 (26%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.