DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb12

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_038946584.1 Gene:Serpinb12 / 304692 RGDID:1566382 Length:423 Species:Rattus norvegicus


Alignment Length:432 Identity:106/432 - (24%)
Similarity:186/432 - (43%) Gaps:92/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIATSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVL---DLPVD 74
            |:|.:  .||..:.. |:..|.|..|....||.:.....|:.:||:|.:|:::..||   :||.|
  Rat     4 LVAAN--NKFCFDFFQEISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAQQIDEVLHFNELPKD 66

  Fly    75 ----VTEMAKK------------------------------------YERIMSNFQK---HNGLR 96
                .:|.:.|                                    :.:::|...:   |..|.
  Rat    67 ERKEPSEPSSKSKASDSSLEGQKQTTASQGQQVSGESTNEHRLLGCHFGKLLSRIDRDKAHYTLS 131

  Fly    97 FTNWLYVNETY--------EVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRTI 153
            ..|.||..:.:        ::.:.|:|.::|....:..:     |:...|:|.:..:|...::.:
  Rat   132 MANRLYGEQEFPICPEYSDDITEFYHTTIESVDFQKDTE-----KSREEINFWVESQSQGKIKEL 191

  Fly   154 SNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIA--DHS 216
            .:...:..:...||||.||:...|:..|..::|....|....|:|..|:||:..|:|||.  :..
  Rat   192 FDKEAIDNSTVLVLVNAVYFKAKWEKEFDSENTVDAPFCLSENEKKTVKMMNQKGQFRIGFIEEL 256

  Fly   217 YGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLS-----------------ESLVENNVHV 264
            ..||:||.:....|||::.||      ||.|..:::|.                 |::.|..|.:
  Rat   257 QAQILEMKYTTGKLSMLVLLP------SSSEDNVKSLQELEKKINHEKLLAWSNPENMSEKPVAI 315

  Fly   265 ELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKINHVVHKSFIEINERGASTGE 328
            ..|:|.::...:|...|:.:||..:|..| :||:| ::......::.||||:|:|::|.|.....
  Rat   316 SFPQFIMEDSYDLNSVLQDMGIRDVFDGTKADLTG-ISKSPSLHLSKVVHKTFVEVDEMGTQAAA 379

  Fly   329 ASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRV 368
            ||. |...:|...:...|..||||:|.||...|  :.|.|||
  Rat   380 ASG-AVVAEKALPSRVEFNANRPFLFFIRHNGTQSLLFCGRV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 102/422 (24%)
Serpinb12XP_038946584.1 serpinB12_yukopin 1..423 CDD:381037 106/432 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.