DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3m

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:387 Identity:97/387 - (25%)
Similarity:165/387 - (42%) Gaps:48/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIATSVLGKFKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE 77
            |...|:...|..:|.: |.:...:.|.:.|||.|...::::.:||||.|.||:..||..     .
  Rat    45 LTLESINTDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRF-----N 104

  Fly    78 MAKKYERIMSNFQKHNGLRFT-----------NWLYVNETYEVRQDYNTLMKS-----TFMAEGK 126
            :.:.||..:.....|...|.:           |.|::::..:|..::....::     .|.|:.:
  Rat   105 LTESYETDIHQGFGHLLQRLSQPGDQVKIITGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQ 169

  Fly   127 DPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVF 191
            .|....|..|  .:..::...|....:|   .|:...|.||||.:.:.|.||..|....|....|
  Rat   170 QPRVTEKLIN--DYVRNQTQGKIQELVS---GLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEF 229

  Fly   192 HGDHNKKVYVRMMS----HVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP----LHNTYLSSIEK 248
            :.|..:.|.|.||.    ....||..:.|. .::|:.:..:..::.| ||    :.....|...:
  Rat   230 YVDEKRSVKVSMMKIEELTTPYFRDEELSC-SVLELKYTGNSSALFI-LPDKGRMQQVEASLQPE 292

  Fly   249 ILRTLSESLVENNV-HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK---IN 309
            .|:...:||....: .:.||:..|.....|.|.|.:|||..:||..:|||.:    ||||   ::
  Rat   293 TLKKWKDSLRPRKIDELYLPRLSISTDYSLEEVLPELGIRDVFSQQADLSRI----TGAKDLSVS 353

  Fly   310 HVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRVV 369
            .||||..:::||.|.....|:. |..:.:..|.......||||:..:...|  |:.|..:|:
  Rat   354 QVVHKVVLDVNETGTEAAAATG-ANLVPRSGRPPMIVWFNRPFLIAVSHTHGQTILFMAKVI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 94/376 (25%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 94/376 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.