DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina6

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:389 Identity:95/389 - (24%)
Similarity:165/389 - (42%) Gaps:80/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIATSVLGKFKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE 77
            |..|:|  .|..||.: ||....:.|.:.||:.|.:.::|:.:|:..|     :|:..|..::||
  Rat    34 LAPTNV--DFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSAQT-----QSLQSLGFNLTE 91

  Fly    78 MAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLM--------KSTFMAEGK-------- 126
                    .|..:.|...::.|:|.......:..:....|        |.:|:|:.|        
  Rat    92 --------TSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEAL 148

  Fly   127 --DPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLK 189
              |.....|||..|:..:..|:...:..:.:|  |....|.:|||.::..|.|:..||.::|:.:
  Rat   149 AIDFEDWTKASQQINQHVKDKTQGKIEHVFSD--LDSPASFILVNYIFLRGIWELPFSPENTREE 211

  Fly   190 VFHGDHNKKVYVRMM---SHVGRFRIADHSYG-QIIEMPFDNSDLSMIIGLPLHNTYLSSIEKIL 250
            .|:.:....|.|.||   ..:|.||  |..:. |:|:|.:..:..:..| ||..    ..::.::
  Rat   212 DFYVNETSTVKVPMMVQSGSIGYFR--DSVFPCQLIQMDYVGNGTAFFI-LPDQ----GQMDTVI 269

  Fly   251 RTLSESLVE--------NNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSG-------LL 300
            ..||...::        ..|::.:|||.|....:|.:.|:.|.|..:.:|.||.||       .|
  Rat   270 AALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDFSGNTKDVPLTL 334

  Fly   301 TNGTGAKINHVVHKSFIEINERGA---STGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT 361
            |         :|||:.::::|...   ||..|..|..|      .....|.|:||:.|:.||.|
  Rat   335 T---------MVHKAMLQLDEGNVLPNSTNGAPLHLRS------EPLDIKFNKPFILLLFDKFT 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 92/381 (24%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 94/386 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.