DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serping1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:369 Identity:84/369 - (22%)
Similarity:160/369 - (43%) Gaps:70/369 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIMSNFQKHNGLRFT 98
            |||:|...||..|...::.:|:||..:|...|..:|..|.|...:.:..:...|     .|:...
  Rat   167 KAETNMAFSPFSIASLLTQVLLGAGDSTKSNLEDILSYPKDFACVHQTLKAFSS-----KGVTSV 226

  Fly    99 NWLYVNETYEVRQDYNTLMKSTFMAE----GKDPLSQRKASNS-ISFSIHRKSHKGMRTISNDHN 158
            :.::.:....:|..|.....|.:.:.    |.|..:..|..|: ::.:.:.|.::.:.::.:|..
  Rat   227 SQIFHSPDLAIRDTYVNASLSLYGSSPRVLGPDGDANLKLINTWVAENTNHKINELLDSLPSDTR 291

  Fly   159 LQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMS----------------HV 207
            |      ||:|.||.|..||..|.:|.......:  .|..:.|.|:|                .|
  Rat   292 L------VLLNAVYLSAKWKKTFEQKKMMASFLY--KNSMIKVPMLSSKKYPLALFNDQTLKAKV 348

  Fly   208 GRFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTY-LSSIEKILR-TLSESLVE-------NNVH 263
            |:.::              :.:||.:|.:|...|: |..:||.|. |:.:::::       ...:
  Rat   349 GQLQL--------------SHNLSFVIMVPQSPTHQLEDMEKALNPTVFKAILKKLELSKFQPTY 399

  Fly   264 VELPKFKIKYQTELVESLKKLGIHLIFSNTSDLS--GLLTNGTGAKINHVVHKSFIEINERGAST 326
            |.:|:.|:|...:::..::||.   .|..|.||:  | ||.....:::.:.|::.:|:.|.|...
  Rat   400 VMMPRIKVKSSQDMLSIMEKLE---FFDFTYDLNLCG-LTEDPDLQVSSMKHETVLELTETGVEA 460

  Fly   327 GEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHTVY--FRGRV 368
            ..||..:.:     |....|:|.:||:||:.|:...:  |.|||
  Rat   461 AAASTISVA-----RNLLIFEVQQPFLFLLWDQRHKFPVFMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 82/367 (22%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 82/367 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.