DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:380 Identity:106/380 - (27%)
Similarity:185/380 - (48%) Gaps:51/380 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDL---------------P 72
            |.|.:|.::.:.:..|...|||.:...:||||:||.||||.::..||.|               .
  Rat    11 FALKVLRVLGEDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFHQCFQ 75

  Fly    73 VDVTEMAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKD------PLSQ 131
            ..:||:.|...|.|        |:.:|.::|.:::|:...:....:..:.||.::      |...
  Rat    76 SLLTEVNKSDRRHM--------LKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQS 132

  Fly   132 RKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHN 196
            |:..|:   .:.:|:...:|.:.:...:..|...||:|:.|:.|.|:..|:|:||:...|....|
  Rat   133 RQHINT---WVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKN 194

  Fly   197 KKVYVRMMSHVGRFR---IADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSI------EKILR- 251
            :|..|:||.:...||   :.|.| ..:..:|:..:.||:.|.||.....|.::      ||::. 
  Rat   195 EKKIVQMMFNKSNFRTYHVEDIS-TTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEW 258

  Fly   252 TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSN-TSDLSGLLTNGTGAKINHVVHKS 315
            |..|::.|..|.:.||:||::...::...|.|||:...|.: .:|.|| :::..|..::.|||||
  Rat   259 TRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSG-ISSKPGLFLSKVVHKS 322

  Fly   316 FIEINERGASTGEASDHAESIQKKTRASTSFKV-NRPFVFLIRD--KHTVYFRGR 367
            .:|:||.|.   ||:...|.:...:..|....| :.||:|||:|  ...:.|.||
  Rat   323 VVEVNEEGT---EAAAPTEIVTMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 106/380 (28%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.