DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb10

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:407 Identity:109/407 - (26%)
Similarity:185/407 - (45%) Gaps:71/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IATSVLGKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDL------- 71
            :|.|: .:|.:...:.:.:.||. |...||..|...::|:.:|.|||||.::..||..       
  Rat     4 LAVSI-NQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFK 67

  Fly    72 --PVDVTEMAK------KYERIMSNFQ-------KHNG---LRFTNWLYVNETYEVRQDYNTLMK 118
              | |..:..|      |.|.|.|:||       ||..   |:..|.:||.:||.....|...||
  Rat    68 FGP-DSEKKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMK 131

  Fly   119 STFMAEGKDPLSQR--KASNSISFSIHRKSHKGMRTISNDHNLQINESA------VLVNTVYYSG 175
            :.|   |.:|.|..  :||..|...|:  |..|.:|.....||..:::.      ||||.:|:.|
  Rat   132 TYF---GAEPQSVNFVEASGQIRKEIN--SWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKG 191

  Fly   176 AWKTRFSKKDTKLKVFHGDHNKKVYVRMMS--------HVGRFRIADHSYGQIIEMPFDNSDLSM 232
            .|:.:||.::|..:.|..:......|:|||        |:...:...      :::.:.|.:.|:
  Rat   192 TWEHQFSVQNTTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIG------VQLHYQNREFSL 250

  Fly   233 IIGLPLHNTYLSSIEKILR-------TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIF 290
            ::.||.....|..:|:.:.       |.::.:....|.:.|||||::...:|..:|:.:|:...|
  Rat   251 LLLLPEEVEGLKQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAF 315

  Fly   291 SNTSDLSGLLTNGTGAKINHVVHKSFIEINERG--ASTGEASDHAESIQKKTRA-STSFKVNRPF 352
            :........:|:.....:::|.||:|:||||.|  |:.|..|:    :..:.:| |.....:.||
  Rat   316 NQGKANFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSE----VNFRIKAPSIELNADHPF 376

  Fly   353 VFLIRDK--HTVYFRGR 367
            :||||..  :|:.|.||
  Rat   377 LFLIRHNVTNTILFYGR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 107/400 (27%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 109/407 (27%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.