DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINA11

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:382 Identity:86/382 - (22%)
Similarity:164/382 - (42%) Gaps:44/382 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKK 81
            |..:..|.|.|.:.:...|..|...||:.|...::::.:||:..|:..:...|...:..|..|..
Human    51 TPTITNFALRLYKELAADAPGNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEADI 115

  Fly    82 YERIMSNFQKHN--------GLRFTNWLYVNETYEVRQDYNTLMKS-----TFMAEGKDPLSQRK 133
            ::...|..  |.        .|:..|.|::::..:.||.|...:|.     .|.|...|.::..:
Human   116 HQGFRSLL--HTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTGR 178

  Fly   134 ASNSISFSIHRKSH----KGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDT-KLKVFHG 193
            ..|..   :.|:::    ..:...|.|..:      ||.|.:::...||..||:..| |.:.|..
Human   179 QINDY---LRRQTYGQVVDCLPEFSQDTFM------VLANYIFFKAKWKHPFSRYQTQKQESFFV 234

  Fly   194 DHNKKVYVRMM--SHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILRT 252
            |....:.|.||  ..:.||.........::::.:..:.|:::: ||    :.....:...:.||.
Human   235 DERTSLQVPMMHQKEMHRFLYDQDLACTVLQIEYRGNALALLV-LPDPGKMKQVEAALQPQTLRK 298

  Fly   253 LSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFI 317
            ..:.|:.:.:.:.||:|.|.....|.:.|.::|:..|.:..:|.|| :|......|:.|.||:.:
Human   299 WGQLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLEADFSG-VTGQLNKTISKVSHKAMV 362

  Fly   318 EINERGASTGEAS---DHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRVV 369
            :::|:|...|.||   ....|:...:.....|  ||||:.|:.:..|  :.|.|:||
Human   363 DMSEKGTEAGAASGLLSQPPSLNTMSDPHAHF--NRPFLLLLWEVTTQSLLFLGKVV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 83/374 (22%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 83/377 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.