DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3n

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:385 Identity:97/385 - (25%)
Similarity:171/385 - (44%) Gaps:61/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIATSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDL---PVD 74
            |...|:...|..:|. :|.:...:.|.:.|||.|...::::.:||||.:.||:...|..   ...
  Rat    45 LTLASINTDFAFSLYKKLALRNPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGLKFNLTETP 109

  Fly    75 VTEMAKKYERIMSNF-QKHNGLRFT--NWLYVNETYEVRQDYNTLMKSTFMAEG--KDPLSQRKA 134
            .||:.:.:..::... |..:.::.:  |.|::.:..:|..::....|:.:.||.  .|....|:|
  Rat   110 ETEIHRGFGHLLQRLSQPRDEIQISTGNALFIEKRLQVLAEFQEKAKALYQAEAFTADFQQSREA 174

  Fly   135 SNSISFSIHRKSH---KGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHN 196
            ...|:..:.:::.   :|:.|     ||....|.||||.:|:.|.||..|..:||....|:....
  Rat   175 KKLINDYVSKQTQGKIQGLIT-----NLAKKTSMVLVNYIYFKGKWKVPFDPRDTFQSEFYSGKR 234

  Fly   197 KKVYVRMM--SHVGRFRIADHSYG-QIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILRTLS 254
            :.|.|.||  ..:....:.|.... .::|:.:..:..::.| ||    :.....|...:.||...
  Rat   235 RPVKVPMMKLEDLTTPYVRDEELNCTVVELKYTGNASALFI-LPDQGKMQQVEASLQPETLRRWK 298

  Fly   255 ESLVENNV-HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK---INHVVHKS 315
            :||..:.: .:.||||.|.....|.:.|.:|||..:||..:||||:    ||.|   ::.||||:
  Rat   299 DSLRPSMIDELYLPKFSISADYNLEDVLPELGIKEVFSTQADLSGI----TGDKDLMVSQVVHKA 359

  Fly   316 FIEINERGASTGEASDHAESIQKKTRASTSFK--------------VNRPFVFLIRDKHT 361
            .:::.|.|.   ||:           |:|..|              .:|||:.:|.|..|
  Rat   360 VLDVAETGT---EAA-----------AATGVKFVPMSAKLDPLIIAFDRPFLMIISDTET 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 95/377 (25%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 97/385 (25%)
RCL 367..394 6/40 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.