DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3c

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:387 Identity:94/387 - (24%)
Similarity:175/387 - (45%) Gaps:49/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIATSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE 77
            |...|:...|.|:|. :|.:...:.|.:.|||.|...::::.:|||.:|.||:  :..|..::||
  Rat    43 LTLASINTDFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEI--LEGLKFNLTE 105

  Fly    78 MAKKYERIMSNF----------QKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEG--KDPLS 130
            :.:  |.|...|          :....:...:.|::::...:..::....::.:.||.  .|...
  Rat   106 ITE--EEIHQGFGHLLQRLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQ 168

  Fly   131 QRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDH 195
            ..:|...|:..:..::...:..:.:|  |....|.||||.:.:.|.||..|:..||....|:.|.
  Rat   169 CNEAKKFINDYVSNQTQGKIAELFSD--LDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDE 231

  Fly   196 NKKVYVRMMSHVGRFRIADHSYG---------QIIEMPFDNSDLSMIIGLP----LHNTYLSSIE 247
            .:.|.|.||      :|.|.:..         .::|:.:..:..::.| ||    :.....|...
  Rat   232 KRSVKVPMM------KIKDLTTPYVRDEELSCSVLELKYTGNASALFI-LPDQGKMQQVESSLQP 289

  Fly   248 KILRTLSESLVENNV-HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK---I 308
            :.|:...:||....: .:.:|||.|.....|.|.|.:|||..|||..:|||.:    ||.|   :
  Rat   290 ETLKKWKDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRI----TGTKNLHV 350

  Fly   309 NHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRV 368
            :.||||:.::::|.|.....|:....:::...:.......||||:.:|.|.:  :|:|.|:|
  Rat   351 SQVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGKV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 91/377 (24%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 91/376 (24%)
RCL 365..392 2/26 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.