DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:389 Identity:91/389 - (23%)
Similarity:173/389 - (44%) Gaps:62/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDL---PVDVTE 77
            :|.|..|..:|. |||.....||...||:.|....:|:.:|:||.|.:::...|:.   .:...:
  Rat    45 SSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEAD 109

  Fly    78 MAKKYERIMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSIS 139
            :.|.:..::....:.:.   |...|.|:||:..::.:.:...:|:.:.:|              :
  Rat   110 IHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSE--------------A 160

  Fly   140 FSIHRKSHKGMRTISNDH------------NLQINESAV--LVNTVYYSGAWKTRFSKKDTKLKV 190
            ||::....:..:.:.||:            ..|::|..|  |||.:::.|.||..|:.:.|:...
  Rat   161 FSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDAD 225

  Fly   191 FHGDHNKKVYVRMMSHVGRFRIADHSY-----GQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKIL 250
            ||.|.:..|.|.||:.:|.|   |..|     ..::.|.:..:..::.: ||..    ..::.:.
  Rat   226 FHVDKSTTVKVPMMNRLGMF---DMHYCSTLSSWVLMMDYLGNATAIFL-LPDD----GKMQHLE 282

  Fly   251 RTLSESLVE--------NNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK 307
            :||::.|:.        .:..:..||..|.....|...|..|||..:|:|.:|||| :|.....|
  Rat   283 QTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSG-ITEDAPLK 346

  Fly   308 INHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRVV 369
            ::..|||:.:.::|||.....|: ..|::.........|  :.||:|:|.:..|  ..|.|:|:
  Rat   347 LSQAVHKAVLTLDERGTEAAGAT-VVEAVPMSLPPQVKF--DHPFIFMIVESETQSPLFVGKVI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/381 (23%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 88/382 (23%)
RCL 367..386 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.