DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpine1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:419 Identity:101/419 - (24%)
Similarity:181/419 - (43%) Gaps:69/419 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGNNKIKYLVLLLIATSVLGK-----------------FKLNLLE-LVMDKAESNFIASPLCIE 47
            ||.::.:..|.|.|:.  |.||                 |.:.:.: :|....:.|.:.||..:.
  Rat     1 MQMSSALTCLTLGLVL--VFGKGFASPLPESHTAQQATNFGVKVFQHVVQASKDRNVVFSPYGVS 63

  Fly    48 IGISMILMGAKGTTAEELRSVLDLPVD----VTEMAKKYERIMSNFQKHNGLRFTNWLYVNETYE 108
            ..::|:.:...|.|.::::..:...:.    ...:.|..:.:|.::.| |.:...:.::|....|
  Rat    64 SVLAMLQLTTAGKTRQQIQDAMGFNISERGTAPALRKLSKELMGSWNK-NEISTADAIFVQRDLE 127

  Fly   109 VRQD--------YNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRTISNDHNL----QI 161
            :.|.        :.|.:|....:|      ..:|...|:..:.|.: |||  ||   :|    .:
  Rat   128 LVQGFMPHFFKLFRTTVKQVDFSE------MERARFIINDWVERHT-KGM--IS---DLLAKGAV 180

  Fly   162 NE--SAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIAD------HSYG 218
            ||  ..||||.:|::|.|||.|.:..|..::||......:.|.||:...:|...:      |.| 
  Rat   181 NELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNYTEFTTPDGHEY- 244

  Fly   219 QIIEMPFDNSDLSMIIGLPLH-NTYLSSIEKIL-----RTLSESLVENNVHVELPKFKIKYQTEL 277
            .|:|:|:....|||.|..|.. :..||:|..||     |....::......:.||||.::.:.:|
  Rat   245 DILELPYHGETLSMFIAAPFEKDVPLSAITNILDAELIRQWKSNMTRLPRLLILPKFSLETEVDL 309

  Fly   278 VESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRA 342
            ...|:|||:..|||:|......|::.....:...:.|..||:||.|.   .||.....:.....|
  Rat   310 RGPLEKLGMTDIFSSTQADFTSLSDQEQLSVAQALQKVKIEVNESGT---VASSSTAILVSARMA 371

  Fly   343 STSFKVNRPFVFLIRDK--HTVYFRGRVV 369
            .|...::|.|:|::|..  .|:.|.|:::
  Rat   372 PTEMVLDRSFLFVVRHNPTETILFMGQLM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 94/395 (24%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 93/389 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.