DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3f

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:378 Identity:93/378 - (24%)
Similarity:163/378 - (43%) Gaps:61/378 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD-LPVDVTEMAKKYERIMSNFQKH 92
            |||:...:.|.:.||..|...::::.:|||..|   |:.:|: |..::||..:.        ..|
Mouse    51 ELVLKNPDENVVFSPFSICTALALLSLGAKSNT---LKEILEGLKFNLTETPEP--------DIH 104

  Fly    93 NGLRFT----------------NWLYVNETYEVRQDYNTLMKSTFMAEG-----KDPLSQRKASN 136
            .|.|:.                :.|::.:..::..::....::.:.||.     :.||...|..|
Mouse   105 QGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLEATKLIN 169

  Fly   137 SISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYV 201
            ..   :...:...::.:.:|  |......||||.:|:.|.|:..|...||....|:.|.|:.|.|
Mouse   170 DY---VSNHTQGKIKELISD--LDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSEFYLDENRSVKV 229

  Fly   202 RMMS----HVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILRTLSESLV 258
            .||.    ....||..:.|. .::|:.:..:..:|.| ||    :.....|...:.||...:||.
Mouse   230 PMMKINNLTTPYFRDEELSC-TVVELKYTGNASAMFI-LPDQGKMQQVEASLQPETLRNWKDSLK 292

  Fly   259 ENNVH-VELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK---INHVVHKSFIEI 319
            ...:: :.||||.|.....|...|.:|||..:||..:|||.:    ||.|   .:.||||:.:::
Mouse   293 PRLINELCLPKFSISTDYSLEHILPELGIRELFSTQADLSAI----TGTKDLRTSQVVHKAVLDV 353

  Fly   320 NERGASTGEASDHAESIQKKTRASTSFKV--NRPFVFLIRD--KHTVYFRGRV 368
            .|.|......:.: :::|.......|.|:  :|||:.:|.|  .|...|..:|
Mouse   354 AETGTEAAAGTGY-QNLQCCQGVIYSMKIYFDRPFLMIISDTNTHIALFMAKV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 92/376 (24%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 92/376 (24%)
RCL 357..382 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.