DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb8

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:388 Identity:112/388 - (28%)
Similarity:174/388 - (44%) Gaps:67/388 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYER 84
            |.|.::||:::.:|.:| |....|:.:...::|:.:||||.||.::..||.|             
Mouse     9 GSFAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGL------------- 60

  Fly    85 IMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKST---FMAEGKDPLSQRKAS---------NS 137
             ..|...|...: |....:|:|     |...|:||.   |..|..|.||..|.|         ..
Mouse    61 -SGNGDVHQSFQ-TLLAEINKT-----DTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEE 118

  Fly   138 ISFSIHRKSHKGMRTISNDHNLQINE----------------SAVLVNTVYYSGAWKTRFSKKDT 186
            :||:   |..:|.|...||...:..|                ..||||.:|:.|.||.:|.:|.|
Mouse   119 LSFA---KDTEGCRKHINDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYT 180

  Fly   187 KLKVFHGDHNKKVYVRMMSHVGRFRI--ADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKI 249
            :...|..:..||. |:||....:|::  .|....|::.:|:...:|||:|.||..:|.|:.:||.
Mouse   181 RGMPFKTNQEKKT-VQMMFKHAKFKMGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKA 244

  Fly   250 LR-------TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGA 306
            |.       |..|:|.|:.|.|.||:.|::...:|...|:.||:...|..| :|.||:.|. ...
Mouse   245 LTYEKLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSGMTTK-KNV 308

  Fly   307 KINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            .::.|.||.|:|:||.|.....|:....: .:..|....|..:.||:|.|....|  :.|.||
Mouse   309 PVSKVAHKCFVEVNEEGTEAAAATAVIRN-ARCCRTEPRFCADHPFLFFIWHHKTSSILFCGR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 111/387 (29%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 112/388 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.