DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3g

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:417 Identity:108/417 - (25%)
Similarity:173/417 - (41%) Gaps:91/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIATSVLGKFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD-LPVDV 75
            |.|::::....|.| ..:||:...:.|.:.||..|...::::.:|||..|   |:.:|: |..::
Mouse    35 LTLVSSNTDFAFSL-YRKLVLKNPDENVVFSPFSICTALALLSLGAKSNT---LKEILEGLKFNL 95

  Fly    76 TEMAKKYERIMSNFQKHNGLRFT----------------NWLYVNETYEVRQDYNTLMKSTFMAE 124
            ||..:.        ..|.|.|:.                :.|::.:..::..::....::.:.||
Mouse    96 TETPEP--------DIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAE 152

  Fly   125 G-----KDPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINES--AVLVNTVYYSGAWKTRFS 182
            .     :.||...|..|.. .|.|.:. |..:.||.     :.||  .||||.:|:.|.||..|.
Mouse   153 AFTADFQQPLKATKLINDY-VSNHTQG-KIKQLISG-----LKESMLMVLVNYIYFKGKWKNPFD 210

  Fly   183 KKDTKLKVFHGDHNKKVYVRMMS----HVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP----LH 239
            ..||....|:.|..:.|.|.||.    ....||..:.|. .::|:.:..:..:|.| ||    :.
Mouse   211 PNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSC-TVVELKYTGNASAMFI-LPDQGRMQ 273

  Fly   240 NTYLSSIEKILRTLSESLVENNVH-VELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNG 303
            ....|...:.||....||....:| :.||||.|.....|...|.:|||..:||..:|||.:    
Mouse   274 QVEASLQPETLRKWKNSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAI---- 334

  Fly   304 TGAK---INHVVHKSFIEINERG----ASTGEAS-------DHAESIQKKTRASTSFKVNRPFVF 354
            ||.|   ::.||||:.:::.|:|    |:||.|.       |..|..           .||||:.
Mouse   335 TGTKDLRVSQVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDFLEIF-----------FNRPFLM 388

  Fly   355 LIRD--KHTVYFRGRVV------RLPN 373
            :|.|  .|...|..:|.      ..||
Mouse   389 IISDTKAHIALFMAKVTNPERSENFPN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 103/394 (26%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 104/396 (26%)
RCL 357..382 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.