DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb9e

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_035586.1 Gene:Serpinb9e / 20710 MGIID:894672 Length:377 Species:Mus musculus


Alignment Length:380 Identity:98/380 - (25%)
Similarity:172/380 - (45%) Gaps:48/380 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLE-LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYER 84
            |.|.::||: |..|....|...||:.|...::|:|:||||.||.::...|.|..| .::.:.::.
Mouse     9 GTFAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPD-EDVHQGFQL 72

  Fly    85 IMSNFQKHNG----LRFTNWLYVNETYEV--------RQDYNTLMKSTFMAEGKDPLSQRKASNS 137
            ::.|..|.|.    |...|.|:|..|.|:        .:.|::.::....||..:...|.     
Mouse    73 LLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFYHSEIEQLSFAEAAEESRQH----- 132

  Fly   138 ISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVR 202
            |:..:.:::...:..:.::.::......:|.|.:|:.|.|...|.|..||...|..:..:...|:
Mouse   133 INMWVSKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTKEVPFKINKKETRPVQ 197

  Fly   203 MMSHVGRFRIADHSY-----GQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR-------TLSE 255
            ||.....|   .|:|     .|::.||::..||:.::.||.....:|.:|..|.       |..|
Mouse   198 MMWQEDTF---FHAYVKEIQAQVLVMPYEGIDLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPE 259

  Fly   256 SLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKINHVVHKSFIEI 319
            .:....:||.|||||::...::...|:.|||..:|:.: :|.||:.|. ....::..|||..:|:
Mouse   260 FMNRTELHVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKADFSGMSTK-ENLCLSKFVHKCVVEV 323

  Fly   320 NERG-----ASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            ||.|     ||.|:.....:....:.     |..:.||:|.|....|  :.|.||
Mouse   324 NEEGTEAVAASAGKIILFCDGPDPEV-----FCADHPFLFFIMHSTTNSILFCGR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 97/379 (26%)
Serpinb9eNP_035586.1 SERPIN 4..377 CDD:294093 98/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.