DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb6b

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_035584.1 Gene:Serpinb6b / 20708 MGIID:894688 Length:377 Species:Mus musculus


Alignment Length:378 Identity:102/378 - (26%)
Similarity:183/378 - (48%) Gaps:48/378 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPV-------DVTEMAK 80
            |.||||:.:.:.:..|.:.||:.:...::|:.||||||||.::...|.|..       ||.:   
Mouse    11 FALNLLKTLGEDSSRNVLFSPISVSSALAMVFMGAKGTTASQMAQALSLDKCSGKGGRDVHQ--- 72

  Fly    81 KYERIMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNS----I 138
            .::.:::...|...   ||..|.|:..:|:::...:....:..:.|| .:.|..:.|:..    |
Mouse    73 GFQSLLTETNKTGTQYVLRTANRLFGEKTFDILASFKDSCRKFYEAE-MEELDFKGATEQSRQHI 136

  Fly   139 SFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRM 203
            :..:.:|:...:..:.:..::..|...||||.:|:.|.|:.:|:|:||:...|:...:....|:|
Mouse   137 NAWVAKKTEDKITELLSSGSVNSNTPLVLVNAIYFKGNWEKQFNKEDTQEMPFNVTKDVVKPVQM 201

  Fly   204 MSHVGRFRI--ADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEK-------ILRTLSESLVE 259
            |.....|::  .:.....|:.:|:..::|:|||.||..:..||.:||       |..|..:.:.|
Mouse   202 MFQKSTFKMTYVEEISTNILLLPYVGNELNMIIMLPDEHIELSMVEKEITYKKFIEWTRLDKMEE 266

  Fly   260 NNVHVELPKFKIKYQTELVESLKKLGIHLIF-SNTSDLSGLLTNGTGAKINHVVHKSFIEINERG 323
            ..|.|.|||||::...::.:.|.:||:...| ...:|.||:.:. .|..::.|:||||:|:||.|
Mouse   267 EEVEVFLPKFKLEENYDMKDVLCRLGMTDAFEEGMADFSGIASK-EGLFLSKVIHKSFVEVNEEG 330

  Fly   324 ASTGEASDHAESIQKKTRASTSFK-------VNRPFVFLIRDKHT--VYFRGR 367
            .....|          |.|:..|:       .|.||:|.|:...|  :.|.||
Mouse   331 TEAAAA----------TAANIGFRCMVPYFCANHPFLFFIQHSRTSGIVFCGR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 102/378 (27%)
Serpinb6bNP_035584.1 serpin 1..377 CDD:393296 102/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.