DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb9c

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:377 Identity:91/377 - (24%)
Similarity:162/377 - (42%) Gaps:43/377 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDL--PVDVTEMAKKY 82
            |.|.:|||.::.:...| |...||:.|...::|.|:|.||.|..::...:.|  .:|:.:.....
Mouse    36 GTFAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGLNTAIDIHQSFLWI 100

  Fly    83 ERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQ---------------R 132
            ..|:....:....|..|.|:...|.|            |:...|:|..|               .
Mouse   101 LNILKKPTRKYTFRMANRLFAENTCE------------FLPTFKEPCLQFYHWEMEHLPFTKAPE 153

  Fly   133 KASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNK 197
            :|.|.|:..:.:.:...:..:.:..::......||||.:|:.|.|..:|..|.|:...|..:.::
Mouse   154 EARNHINTWVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDE 218

  Fly   198 KVYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR-------TL 253
            :..|:||.....|::|  :....|::.:|:...:||:::.||.....||.:|..|.       |.
Mouse   219 ERPVQMMFQEDMFKLAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTK 283

  Fly   254 SESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIF-SNTSDLSGLLTNGTGAKINHVVHKSFI 317
            .:.|....|.|.|||||::...::....:.||:..|| ...:|||. ::...|..::..:.|..:
Mouse   284 PDYLKTTKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGKADLSE-MSPERGLCVSKFIQKCVV 347

  Fly   318 EINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            |:||.|.....|:........:|....:|..:.||:|.||...|  :.|.||
Mouse   348 EVNEEGTEATAATADDTVCSAETHDGQTFCADHPFLFFIRHNKTNSILFCGR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 90/376 (24%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 91/377 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.