DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina1e

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:395 Identity:93/395 - (23%)
Similarity:165/395 - (41%) Gaps:70/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IATSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEM 78
            |||: ||.|.::|. |||.....||...||:.|....:|:.:|:||.|..::...|...:..|..
Mouse    44 IATN-LGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE 107

  Fly    79 A---KKYERIMSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNS 137
            |   ..::.::....:.:.   |...|.|:||...::.:.:....|:.:.||             
Mouse   108 ADIHNSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAE------------- 159

  Fly   138 ISFSIHRKSHKGMRTISND--------------HNLQINESAVLVNTVYYSGAWKTRFSKKDTKL 188
             .||::....:..:.:.||              ..|:.:...||.|.:.:.|.||..|..::||.
Mouse   160 -VFSVNFAESEEAKKVINDFVEKGTQGKIVEAVKKLEQDTVFVLANYILFKGKWKKPFDPENTKQ 223

  Fly   189 KVFHGDHNKKVYVRMMSHVGRFRIADHS--YGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILR 251
            ..||.|.:..|.|.||:..|...:...|  ...::.|.:..:..::.: ||..    ..::.:.:
Mouse   224 AEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFL-LPDD----GKMQHLEQ 283

  Fly   252 TLSESLVENNV--------HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKI 308
            ||::.|:...:        .:.:|:..|.....|...:..|||..||::.:||||:.......|:
Mouse   284 TLNKELISKFLLNRRRRLAQIHIPRLSISGNYNLETLMSPLGITRIFNSGADLSGITEENAPLKL 348

  Fly   309 NHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSF-------KVNRPFVFLIRDKH--TVYF 364
            :..|||:.:.|:|.|.....|          |.....|       ..||||:|:|.::|  :..|
Mouse   349 SQAVHKAVLTIDETGTEAAAA----------TVLQGGFLSMPPILHFNRPFLFIIFEEHSQSPLF 403

  Fly   365 RGRVV 369
            .|:||
Mouse   404 VGKVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 86/385 (22%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 87/385 (23%)
RCL 368..387 3/28 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.