DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINB1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:393 Identity:103/393 - (26%)
Similarity:173/393 - (44%) Gaps:74/393 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNL-LELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERI 85
            :|.|:| |.|..:....|...||..|...::|:.:|.:|.||.:|........ |.|:..:::.:
Human    10 RFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNT-VEEVHSRFQSL 73

  Fly    86 MSNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSH 147
            .::..|...   |:..|.||..:||....::....:.|:.|:            ..|......|.
Human    74 NADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGAD------------LASVDFQHASE 126

  Fly   148 KGMRTISN-------------------DHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHG 193
            ...:||:.                   |:..::    ||||.:|:.|.||.:|.|:.|....|..
Human   127 DARKTINQWVKGQTEGKIPELLASGMVDNMTKL----VLVNAIYFKGNWKDKFMKEATTNAPFRL 187

  Fly   194 DHNKKVYVRMMSHVGRFRIADHSYG-------QIIEMPFDNSDLSMIIGLP----LHNTYLSSIE 247
            :...:..|:||....:|     :||       :::|:|:...:|||:|.||    ..:|.|..||
Human   188 NKKDRKTVKMMYQKKKF-----AYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIE 247

  Fly   248 KILR-------TLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIF-SNTSDLSGLLTNGT 304
            :.|.       |..|:|....|:|.||:||::....|...|.:||:..:| |:.:||||:    :
Human   248 EQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGM----S 308

  Fly   305 GAK---INHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIR--DKHTVYF 364
            ||:   |:.:|||||:|:||.|.....|:....:. .......:|..:.||:|.||  ...::.|
Human   309 GARDIFISKIVHKSFVEVNEEGTEAAAATAGIATF-CMLMPEENFTADHPFLFFIRHNSSGSILF 372

  Fly   365 RGR 367
            .||
Human   373 LGR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 103/393 (26%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 103/393 (26%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.