DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina12

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:381 Identity:98/381 - (25%)
Similarity:176/381 - (46%) Gaps:53/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELR--------SVLDLPVDVTEMA 79
            ||| |..|..:..:.|...|||.|....||:.:||:.:|.||:|        |..|:.:....:.
  Rat    57 FKL-LQRLASNSRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDMHMGFHYLL 120

  Fly    80 KKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAE-----GKDPLSQRKASNSIS 139
            :|..|...:.:...|    |.|::::....:|.:..|.|:.:.|:     .:|..:.:|   :|:
  Rat   121 QKLNRETQDVKMSIG----NALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLENTQK---NIN 178

  Fly   140 FSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMM 204
            ..|.||:|..:..:..  |:......:|.|.:|:.|.|:..|..|.||.:.|..:..|.|.|.||
  Rat   179 KYISRKTHNRIENMVK--NIDPGTVMLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMM 241

  Fly   205 SHVGRFRIADHSYGQ-----IIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRT---------LSE 255
            ...|.:   |.:|..     |:|||: ..:::....|| .:..|..:|:.|:.         ||:
  Rat   242 FQRGMY---DMAYDSQLSCTILEMPY-RRNITATFVLP-DSGKLRLLEQGLQADIFAKWKSLLSK 301

  Fly   256 SLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEIN 320
            .:|:    |.:|:..|.....:.:.|.:|||..||....||: .:::....|:...|||:.:.:|
  Rat   302 RVVD----VWVPRLHISATYNMKKVLSRLGISKIFEEHGDLT-RISSHRSLKVGEAVHKAELRMN 361

  Fly   321 ERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDK--HTVYFRGRVVRLPNE 374
            |:| :.|.|...|:::..:|  ....|:|.||:.:|.:.  .::.|..|:.. |:|
  Rat   362 EKG-TEGAAGSGAQTLPMET--PRRMKLNAPFLMMIYENLMPSMIFLARIYN-PSE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 95/373 (25%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 95/373 (25%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.