DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinf2

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:370 Identity:96/370 - (25%)
Similarity:170/370 - (45%) Gaps:40/370 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELV-MDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIM 86
            |..:|..|| .....||.:.|||.:.:.:|.:.:||:..|...|..||.:     ........::
Mouse    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHM-----NTGSCLPHLL 148

  Fly    87 SNFQKHNG---LRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHK 148
            |:|.::.|   :|....:|:.:.:.::.|:....:..|   |..|:...........:|::...:
Mouse   149 SHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLF---GAKPVKLTGKQEEDLANINQWVKE 210

  Fly   149 GMRTISNDHNLQINESAV--LVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVG--- 208
            .......|...::.:|.|  |:|.:::.|.|:|:|....|:...||.|....|.|.||..|.   
Mouse   211 ATEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPL 275

  Fly   209 RFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLS-SIEKILRTLS------ESLVENNVHVEL 266
            |:.:.:....|:...||.| ::|.::.:|   ||.. ::.::|..|:      .||.|....|.|
Mouse   276 RWFLLEQPEIQVAHFPFKN-NMSFVVVMP---TYFEWNVSEVLANLTWDTLYHPSLQERPTKVWL 336

  Fly   267 PKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASD 331
            ||..::.|.:||.:|.:||:..:|.. .||.|:  :.....::.|.|:|.:|::|.|.....|: 
Mouse   337 PKLHLQQQLDLVATLSQLGLQELFQG-PDLRGI--SEQNLVVSSVQHQSTMELSEAGVEAAAAT- 397

  Fly   332 HAESIQKKTRASTSFKVNRPFVFLIRDKHTV---YFRGRVVRLPN 373
               |:.....:.:||.|||||:|.|.: .|:   .|.|. ||.||
Mouse   398 ---SVAMNRMSLSSFTVNRPFLFFIME-DTIGVPLFVGS-VRNPN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 92/363 (25%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 92/364 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.