DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpine1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:423 Identity:103/423 - (24%)
Similarity:186/423 - (43%) Gaps:77/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGNNKIKYLVLLLIATSVLGKFKLNLLE-----------------LVMDKAESNFIASPLCIEI 48
            ||.::.:..|:|.|:..|..| |.|.|.|                 :|....:.|.:.||..:..
Mouse     1 MQMSSALACLILGLVLVSGKG-FTLPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSS 64

  Fly    49 GISMILMGAKGTTAEELRSVLDLPVD-------VTEMAKKYERIMSNFQKHNGLRFTNWLYVNET 106
            .::|:.|...|.|..:::..:...|:       :.:::|:   :|..:.| |.:...:.::|...
Mouse    65 VLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLSKE---LMGPWNK-NEISTADAIFVQRD 125

  Fly   107 YEVRQD--------YNTLMKSTFMAEGKDPLSQRKASNSISFSIHRKSHKGMRTISN-------D 156
            .|:.|.        :.|::|....:|      ..:|...|:..:.|.: |||  ||:       |
Mouse   126 LELVQGFMPHFFKLFQTMVKQVDFSE------VERARFIINDWVERHT-KGM--ISDLLAKGAVD 181

  Fly   157 HNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHS----- 216
            ...::    ||||.:|:||.|||.|.:..|..::||......|.|.||:...:|...:.:     
Mouse   182 ELTRL----VLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFNYTEFTTPDGL 242

  Fly   217 -YGQIIEMPFDNSDLSMIIGLPLH-NTYLSSIEKIL-----RTLSESLVENNVHVELPKFKIKYQ 274
             | .::|:|:....|||.|..|.. :.:||::..||     |....::......:.||||.::.:
Mouse   243 EY-DVVELPYQGDTLSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMTRLPRLLILPKFSLETE 306

  Fly   275 TELVESLKKLGIHLIFSNT-SDLSGLLTNGTGAKINHVVHKSFIEINERGASTGEASDHAESIQK 338
            .:|...|:|||:..:||.| :|.:. |::.....:...:.|..||:||.|.   .||.....:..
Mouse   307 VDLRGPLEKLGMPDMFSATLADFTS-LSDQEQLSVAQALQKVRIEVNESGT---VASSSTAFVIS 367

  Fly   339 KTRASTSFKVNRPFVFLIRDK--HTVYFRGRVV 369
            ...|.|...::|.|:|::|..  .|:.|.|:|:
Mouse   368 ARMAPTEMVIDRSFLFVVRHNPTETILFMGQVM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 95/399 (24%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 92/394 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.