DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina10

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_598301.2 Gene:Serpina10 / 171154 RGDID:621220 Length:436 Species:Rattus norvegicus


Alignment Length:375 Identity:96/375 - (25%)
Similarity:181/375 - (48%) Gaps:45/375 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDL-------PVDVTEMAK 80
            |..:||..:..:.:.|.|.||..:.:.:..:::||||.|..::.:.|:|       |:.:..:.|
  Rat    74 FGFSLLRKISMRHDGNVIFSPFGLSVAMVNLMLGAKGETKVQVENGLNLQALSQAGPLILPALFK 138

  Fly    81 KYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPLSQRKASNS---ISFSI 142
            :.:...|: .|..||...::.::::.:|:::.|..|....|..| ..|.:.|.:|.:   ::..|
  Rat   139 RVKETFSS-NKKLGLTQGSFAFIHKDFEIKKTYFNLSTMYFDTE-YVPTNFRNSSQARGLMNHYI 201

  Fly   143 HRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHV 207
            ::::...:..:.::.|.:  ...:||:.:.:.|.|.|.|....|:...||.|..|.|.|.||...
  Rat   202 NKETEGKIPKLFDEINPE--TKLILVDYILFKGKWLTPFDPIFTEADTFHLDKYKAVKVPMMYRE 264

  Fly   208 GRFRIA-DHSYG-QIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLSESLVE--------NNV 262
            |.|... |..:. .|:::|:..:...:::.:.....:| ::|..|.|   .|||        ..:
  Rat   265 GNFASTFDKKFRCHILKLPYQGNATMLVVLMEKSGDHL-ALEDYLTT---DLVEMWLQDMKTRKM 325

  Fly   263 HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGASTG 327
            .|..||||:..:.|:.|.||::||..|||.::|||.|.......:::.||.:|.:|::|||    
  Rat   326 EVFFPKFKLNQRYEMHELLKQVGIRRIFSTSADLSELSAVARNLQVSKVVQQSVLEVDERG---- 386

  Fly   328 EASDHAESIQKKTRASTSF------KVNRPFVFLIRDK--HTVYFRGRVV 369
                 .|.:.......|::      ||:|||.|:|.::  ..:.|.||||
  Rat   387 -----TEVVSGTVSEITAYCMPPVIKVDRPFHFIIYEEMSQMLLFLGRVV 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 93/372 (25%)
Serpina10NP_598301.2 SERPIN 66..430 CDD:294093 93/372 (25%)
Heparin-binding. /evidence=ECO:0000250 128..145 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.