DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpini2

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001127881.1 Gene:Serpini2 / 171149 RGDID:619897 Length:405 Species:Rattus norvegicus


Alignment Length:372 Identity:104/372 - (27%)
Similarity:185/372 - (49%) Gaps:35/372 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIM 86
            :|.::|.:.:....::|.|.|||...:.:.|:.:||||...:::...|.:  ..|...:::..:.
  Rat    28 EFAVDLYKAISLSNKNNVIFSPLGTTVLLGMVQLGAKGKAQQQIMQTLRM--QKTSTGEEFSVLK 90

  Fly    87 SNF----QKHNGLRF--TNWLYVNETYEVRQDYNTLMKSTFMAEGK--DPLSQRKASNSISFSIH 143
            |.|    :|.....|  .:.||:.|.:.|::.|....|..|.:..|  |.|..:.::.:||..:.
  Rat    91 SLFSAISKKKQEFTFNLASALYLQEGFIVKESYLHSNKEFFQSATKLVDFLDAKTSAQAISTWVE 155

  Fly   144 RKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRMM---- 204
            .|:...::.:.::.:.......||||.:|:.|.||.:|.|:||::..|.......|.:.||    
  Rat   156 SKTDGKIKNMFSEEDFGPLTRLVLVNAIYFKGDWKQKFRKEDTEMTDFSKKDGSTVKIPMMKALL 220

  Fly   205 -SHVGRFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEK------ILRTLSESLVENNV 262
             :..|.|..:..:| |::|:|:...:.|::|.||..:..:..:||      :.:..|| |.|..|
  Rat   221 RAKYGYFSESSMTY-QVLELPYKADEFSLVILLPTEDVNIEEVEKQVTARHVQKWFSE-LHEEEV 283

  Fly   263 HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERG---- 323
            .|.||:|||:.:.:..|:|..|.:..|||...|||| :|:.:...::..:.|.|.||||.|    
  Rat   284 EVSLPRFKIEQKLDFKEALFSLNVTEIFSGGCDLSG-ITDSSELYVSRAMQKVFFEINEDGSEAA 347

  Fly   324 ASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGRV 368
            ||||   .:..:|...|:  |.|..|.||:|:::...|  :.|.|:|
  Rat   348 ASTG---INIPAIMSLTQ--TQFLANHPFLFIMKHIQTESILFMGKV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 103/370 (28%)
Serpini2NP_001127881.1 SERPIN 23..405 CDD:294093 104/372 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.