DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpina3c

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_011242304.1 Gene:Serpina3c / 16625 MGIID:102848 Length:436 Species:Mus musculus


Alignment Length:385 Identity:102/385 - (26%)
Similarity:175/385 - (45%) Gaps:48/385 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIATSVLGKFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE 77
            |...|:...|..:|. :|.:...::|.:.|||.|...::::.:||||.|.||:...|:..:..|.
Mouse    64 LTLASINTDFAFSLYKKLALKNPDTNIVFSPLSISAALAIVSLGAKGNTLEEILEGLNFNLTETP 128

  Fly    78 MAKKYERIMSNFQK--HNG----LRFTNWLYVNETYEVRQDYNTLMKSTFMAEG-----KDPLSQ 131
            .|..::......|:  |.|    :...:.|:|.:..::..::....::.:.||.     :.||..
Mouse   129 EADIHQGFGHLLQRLSHPGEQVQISTGSALFVEKHLQILAEFQEKARALYQAEAFTADFQQPLEA 193

  Fly   132 RKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHN 196
            .|..|....:..::..||:  ||   :|..:...||||.:|:.|.||..|:.:||....|:.|..
Mouse   194 TKLINDYVSNQTQRKIKGL--IS---DLDTDTLMVLVNYIYFKGKWKMPFNPRDTFESEFYLDVK 253

  Fly   197 KKVYVRMMS----HVGRFRIADHSYGQIIEMPFDNSDLSMIIGLP----LHNTYLSSIEKILRTL 253
            :.|.|.||.    ....||..:.|. .::|:.:..:..::.| ||    :.....|...:.||..
Mouse   254 RSVKVPMMKIKTLTTPYFRDEELSC-TVVELKYKGNASALFI-LPDQGRMQQVEASLQPETLRKW 316

  Fly   254 SESLVENNV-HVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAK---INHVVHK 314
            ..||....: .:.||||.|.....|...|.:|||..|||..:||||:    ||.|   ::.:|||
Mouse   317 KNSLRPRKMGELYLPKFSISTDYSLKNILPELGIKEIFSKQADLSGI----TGTKDLIVSQMVHK 377

  Fly   315 SFIEINERG----ASTGEASDHAESIQKKTRASTSFKVNRPFVFLI--RDKHTVYFRGRV 368
            :.:::.|.|    |:||.   :...:.::    ||...||.|:.:|  .|..|..|..::
Mouse   378 AVLDVAETGTEGVAATGV---NFRILSRR----TSLWFNRTFLMVISHTDVQTTLFIAKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 100/375 (27%)
Serpina3cXP_011242304.1 serpinA3_A1AC 56..434 CDD:381019 102/385 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.