DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and SERPINA12

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:393 Identity:93/393 - (23%)
Similarity:168/393 - (42%) Gaps:86/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLLELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIMS 87
            ||| |.:|.......|...|||.|....||:.:||:.:|.:|::...                  
Human    57 FKL-LKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGF------------------ 102

  Fly    88 NFQK------HNGLRFTNWLYVNETYEVRQDY-----NTLM-------KSTFMAEGKD------- 127
            ||:|      |.|..:    .::|..:..||.     |||.       :..|:.:.|:       
Human   103 NFRKMPEKDLHEGFHY----IIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETI 163

  Fly   128 -------PLSQRKASNSISFSIHRKSHKGMRTISN-DHNLQINESAVLVNTVYYSGAWKTRFSKK 184
                   .::|::.::.||...|.|       |:| ..|:......:|.|.:::...||..|...
Human   164 LTNFQNLEMAQKQINDFISQKTHGK-------INNLIENIDPGTVMLLANYIFFRARWKHEFDPN 221

  Fly   185 DTKLKVFHGDHNKKVYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIE 247
            .||.:.|..:.|..|.|.||...|.:::.  |.....|:|:|: ..:::.|..|| ....|..:|
Human   222 VTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPY-QKNITAIFILP-DEGKLKHLE 284

  Fly   248 KILRT---------LSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNG 303
            |.|:.         ||..:|:    |.:|:..:....:|.::|..:|:..||....||:.:..: 
Human   285 KGLQVDTFSRWKTLLSRRVVD----VSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPH- 344

  Fly   304 TGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRG 366
            ...|:...|||:.::::||| :.|.|...|:::..:|  ....|:::|::.||..:.  :|.|.|
Human   345 RSLKVGEAVHKAELKMDERG-TEGAAGTGAQTLPMET--PLVVKIDKPYLLLIYSEKIPSVLFLG 406

  Fly   367 RVV 369
            ::|
Human   407 KIV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 92/390 (24%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 93/393 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.