DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinh1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:376 Identity:91/376 - (24%)
Similarity:161/376 - (42%) Gaps:60/376 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKKYERIMSNFQKHNG 94
            :..|:|..|.:.|||.:...:.::.:|.|.|||.:.::||.        |:|    :.:.:.|.|
Mouse    57 MAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLS--------AEK----LRDEEVHTG 109

  Fly    95 L------------RFTNW-----LYVNETYEVRQDYNTLMKSTFMAEG-----KDPLSQRKASNS 137
            |            |...|     ||...:.....|:....|..:..|.     :|   :|.|..|
Mouse   110 LGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRD---KRSALQS 171

  Fly   138 ISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVR 202
            |:....:.:...:..::.|  ::..:.|:|||.:::...|..:|..|....:.|....:..|.|.
Mouse   172 INEWASQTTDGKLPEVTKD--VERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVT 234

  Fly   203 MMSHVGRFRIADHSYG--QIIEMPFDNSDLSMIIGLPLHNTYLSSIEKI-----LRTLSESLVEN 260
            ||...|.:...|....  |::|||..:...|:||.:|.|...|..:||:     |:.....:.:.
Mouse   235 MMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQKK 299

  Fly   261 NVHVELPKFKIKYQTELVESLKKLGI-HLIFSNTSDLSGLLTNGTGAK---INHVVHKSFIEINE 321
            .|.:.|||..::...:|.:.|..||: ..|..|.:|||.:    :|.|   :..|.|.:..|.: 
Mouse   300 AVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM----SGKKDLYLASVFHATAFEWD- 359

  Fly   322 RGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKH--TVYFRGRVVR 370
               :.|...|.....:::.|:...|..:.||:||:||..  ::.|.||:||
Mouse   360 ---TEGNPFDQDIYGREELRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 88/372 (24%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 91/376 (24%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.