DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinc1

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus


Alignment Length:374 Identity:95/374 - (25%)
Similarity:180/374 - (48%) Gaps:31/374 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNLLELVMDKA--ESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE------- 77
            :|..|..:.:.|..  ..|...|||.|....:|..:||...|.::|..|..... ::|       
Mouse    90 RFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDT-ISEKTSDQIH 153

  Fly    78 --MAKKYERIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPL----SQRKASN 136
              .||...|:.....|.:.|...|.|:.:::....:.|..:.:..:.|: ..||    :..::..
Mouse   154 FFFAKLNCRLYRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAK-LQPLDFKENPEQSRV 217

  Fly   137 SISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYV 201
            :|:..:..|:...::.:.....:....:.|||||:|:.|.||::||.::|:.:.|:....:...|
Mouse   218 TINNWVANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCPV 282

  Fly   202 RMMSHVGRF---RIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIE-----KILRTLSESLV 258
            .||...|:|   |:|:.:  |::|:||...|::|::.||.....|:.:|     ::|:...:.|.
Mouse   283 PMMYQEGKFKYRRVAEGT--QVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDELS 345

  Fly   259 ENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNG-TGAKINHVVHKSFIEINE 321
            |..:.|.:|:|:.:....|.|.|:.:|:..:|| ..|.|.|::..| ....::...||:|:|:||
Mouse   346 ETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSDAFHKAFLEVNE 410

  Fly   322 RGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRD--KHTVYFRGRV 368
            .|:....::....:.:.......:||.||||:.|||:  .:|:.|.|||
Mouse   411 EGSEAAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 93/372 (25%)
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 95/374 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.