DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and Serpinb5

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_476449.2 Gene:Serpinb5 / 116589 RGDID:69342 Length:375 Species:Rattus norvegicus


Alignment Length:380 Identity:106/380 - (27%)
Similarity:187/380 - (49%) Gaps:37/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIATSVLGKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVT 76
            |.:|.|.   |.:.|.:.:.:|..: |.:.||:|:...:|:..:||||.||.|:..||... :|.
  Rat     4 LRLANSA---FAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHFE-NVK 64

  Fly    77 EMAKKYERIMSNFQKHN---GLRFTNWLYVNETYEVRQDYNTLMKSTFMAE-----GKDPLSQRK 133
            ::...::.|.|:..|.:   .|:....||::::..:..::.:..|..:..|     .||.|.:.|
  Rat    65 DVPFGFQTITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVDFKDKLEETK 129

  Fly   134 ASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKK 198
              ..|:.||...:......|..::::......::||..|:.|.|..:|.:.:||...|..:....
  Rat   130 --GQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRINKTDT 192

  Fly   199 VYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPL----HNTYLSSIEK------ILR 251
            ..|:||:....|.:.  |....:|||:||.|..|||:|.||.    .:|.|..|||      :|:
  Rat   193 KPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEKQLNPETLLQ 257

  Fly   252 TLSESLVEN-NVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSDLSGLLTNGTGAKINHVVHK 314
            ..:.|.:.| .|.:.|||||::...:...||:.||:..:|: :|||.|| ::...|..:::|:|:
  Rat   258 WTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSG-MSETKGVSVSNVIHR 321

  Fly   315 SFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            ..:||.|.|..:.|... :..:|.|    ..||.:.||:|::|...|  :.|.|:
  Rat   322 VCLEITEDGGDSIEVPG-SRILQHK----DEFKADHPFLFIVRHNKTRNIVFLGK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 103/371 (28%)
Serpinb5NP_476449.2 serpinB5_maspin 1..375 CDD:381013 106/380 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.