DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpinb11

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_002936466.1 Gene:serpinb11 / 100490487 XenbaseID:XB-GENE-6039640 Length:401 Species:Xenopus tropicalis


Alignment Length:397 Identity:90/397 - (22%)
Similarity:175/397 - (44%) Gaps:56/397 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGKFKLNLLELVMDKAES-NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLP----------- 72
            :.:|.|::.:.:....|: |...||:.|...:.::.:|::..||.:::.|:..|           
 Frog     8 INEFSLDIFKELNSSCENKNIFFSPMSISAALYLLHLGSREDTATQIQKVVRYPDVKKEGFFRRR 72

  Fly    73 -------------VDVTEMAK------KYERIMSNF---QKHNGLRFTNWLYVNETYEVRQDYNT 115
                         .||:|..|      |:..::|..   .|...|:..|.::....:...|.|..
 Frog    73 CATQQRSNEESPGKDVSECGKVSDAHSKFHALLSKLTEDPKGVELQIANGMFAQMNFPFLQQYLE 137

  Fly   116 LMKSTFMAEGKD-PLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKT 179
            ..::.:.|:.:: ...:.:...:|:..:..|:...::.:...::|....:.||||.:|:.|.|..
 Frog   138 CAQALYNAKLQNVDFEKDETRENINSWVESKTQGKIKDLFEKNSLDKRTALVLVNAIYFKGIWSN 202

  Fly   180 RFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIA--DHSYGQIIEMPFDNSDLSMIIGLPLHNTY 242
            .|.:..||...|:...:....|.||....:|.:.  .....||:|:|:....|||.|.|......
 Frog   203 PFQEVHTKDAPFYVSKDVVKSVPMMYQSQKFNLGAIKELNAQILELPYQLGALSMFILLTNEKFG 267

  Fly   243 LSSIEKIL--RTLSESL--VEN-NVHVELPKFKIKYQTELVESLKKLGIHLIFSNT-SDLSGLLT 301
            |..||:.|  ..|::.:  :|| .:.|.:|:|:::...:|...|..:|:...||.. ::|||:  
 Frog   268 LQKIEQQLSWNYLAKGMSNMENTKLDVYIPRFRLEESLDLGSHLINMGMVDAFSEAKANLSGI-- 330

  Fly   302 NGTGAKINHVVHKSFIEINERG----ASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRD--KH 360
            :.....::.:|||:|:|:||.|    |:||     .:...|.......||.:..|:|.|:|  ..
 Frog   331 SDVPLYVSKIVHKAFVEVNEEGTVAAAATG-----VQIAPKMAVIPRVFKADHSFLFFIKDNPND 390

  Fly   361 TVYFRGR 367
            |:.|.|:
 Frog   391 TILFFGK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 90/395 (23%)
serpinb11XP_002936466.1 serpinB 7..398 CDD:381072 90/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.