DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpinb4

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_002936465.2 Gene:serpinb4 / 100490314 XenbaseID:XB-GENE-5787878 Length:392 Species:Xenopus tropicalis


Alignment Length:390 Identity:103/390 - (26%)
Similarity:177/390 - (45%) Gaps:57/390 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTEMAKK---- 81
            :|.|:|. ||..:..:.|.:.|||.|...:.::|:|:||.||.|:..|...|......:.|    
 Frog    10 EFSLDLCKELKKNPEKKNILFSPLSICSAMGLVLLGSKGDTAAEIEKVFHFPAAAGSRSSKPSCQ 74

  Fly    82 ------------YERIMSNFQK---HNGLRFTNWLYVNETYE--------VRQDYNTLMKST-FM 122
                        ::.:.|...|   |..|...|..|..:::.        :.|.||..::|. |.
 Frog    75 QQTCQAQGVHLLFKDLFSTLNKPNDHYELSIANRAYGEKSFPFSEQYLLCIEQLYNATLESVDFK 139

  Fly   123 AEGKDPLSQRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTK 187
            .:..|.:.|      |:..:..|:...::.:....:|....:..|||.||:.|:||.:|.|::|.
 Frog   140 TKADDVIQQ------INAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFKKENTT 198

  Fly   188 LKVFHGDHNKKVYVRMMSHVGRFRIADHS--YGQIIEMPFDN---------SDLSMIIGLPLHNT 241
            ...|..:.|.|..|:|||..|::::..:.  ..:|:::|::.         .|:..:..|..|.|
 Frog   199 DAPFFLNKNDKTSVKMMSQKGKYKLGSNPELKCRILKLPYEEGFSMKIILPDDIDGLAELETHLT 263

  Fly   242 Y--LSSIEKILRTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGT 304
            |  .:.:..:.||.     |..|.|:||:||......|.|.|:.:|:...| :.::||| :::..
 Frog   264 YETFTKLMDLQRTR-----EVQVVVKLPQFKFGETYSLTEVLQSMGMTSAF-HGANLSG-ISDKA 321

  Fly   305 GAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRDKHT--VYFRGR 367
            |..|:.|||||:||:||.|.....|:....::.........|.|:|||:|.|....|  :.|.||
 Frog   322 GLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPLPPQEFIVDRPFLFCIEHISTKSLLFYGR 386

  Fly   368  367
             Frog   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 103/390 (26%)
serpinb4XP_002936465.2 serpinB 10..387 CDD:381072 103/390 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.