DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Db and serpinf2

DIOPT Version :9

Sequence 1:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_002937193.2 Gene:serpinf2 / 100170598 XenbaseID:XB-GENE-877015 Length:594 Species:Xenopus tropicalis


Alignment Length:376 Identity:94/376 - (25%)
Similarity:182/376 - (48%) Gaps:53/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKLNLL-ELVMDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE---MAKKYE 83
            |.::|| |:..:..:.:.:.||..|.:|:..:.:||    .:|:::.|...:.|..   :..|.:
 Frog   226 FSIDLLKEIDPESKKPSVVMSPFSIALGLLQLSLGA----GKEMQNKLMETLHVESLHCLHNKLK 286

  Fly    84 RIMSNFQKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGKDPL----SQRKASNSISFSIHR 144
            .:.....| :.||....:|:.:.::::..:   :||:....|..||    |::|...||      
 Frog   287 TVRKELSK-SILRTATRIYLKKGFQIKDSF---LKSSEKWYGSKPLHLGGSKKKNLESI------ 341

  Fly   145 KSHKGMRTISNDH------NLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDHNKKVYVRM 203
              :|.::.|:...      :|..:...:|:|.:::.|.||..|....|....|:.:.:..|.|.|
 Frog   342 --NKWVKDITEGQIPHFLSDLPQDVLLILLNAMHFKGVWKNTFDPSLTSEDSFYINDDMSVPVEM 404

  Fly   204 MS---HVGRFRIADHSYGQIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLSESLV------E 259
            ||   :...:...:....|:.:..| ..::|.::.:|..:|:  ::.|:|...|:|.:      |
 Frog   405 MSAQKYPFSWFFLESIESQVAKFQF-KGNMSFVVLMPYSSTW--NLSKLLANFSQSDLYSRFPRE 466

  Fly   260 NNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERGA 324
            .|.::::||..:.|:.||...|..||:..:|:| .|||| :|| ....::.:.|:|.:|:||.|.
 Frog   467 KNTNLKMPKLNLDYKLELRNPLTNLGLGQLFTN-PDLSG-ITN-EALVVSSIQHQSSLELNEEGV 528

  Fly   325 STGEASDHAESIQKKTRASTSFKVNRPFV-FLIRDKHTV-YFRGRVVRLPN 373
               |||  |.:....:|:.:.:::||||: ||..|...: .|.|. ||.||
 Frog   529 ---EAS--AVTAVITSRSHSVYRINRPFLFFLFEDTMGIPLFMGH-VRNPN 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 90/369 (24%)
serpinf2XP_002937193.2 PRK12495 <18..>140 CDD:183558
PHA03169 <89..>215 CDD:223003
serpinF2_A2AP 212..574 CDD:381009 94/376 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.