DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33120 and AT5G22490

DIOPT Version :9

Sequence 1:NP_788073.1 Gene:CG33120 / 326260 FlyBaseID:FBgn0053120 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_197641.1 Gene:AT5G22490 / 832310 AraportID:AT5G22490 Length:482 Species:Arabidopsis thaliana


Alignment Length:415 Identity:85/415 - (20%)
Similarity:140/415 - (33%) Gaps:138/415 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 NINNHVLLS--THKYRGRPVSESNIQEYVSELATKYIPSD--LPQWQVIVIPNSDSTQPYYILIK 193
            |:..||.:.  ..|.....| |..:::|:|.:.  .||.|  .|.|:|.::....|......:|:
plant    76 NVEEHVFVPDIDPKLTEEDV-EWFVEDYISSIT--MIPLDRTKPLWEVHILNAKTSDAEAICVIR 137

  Fly   194 LHHLIIAEEEDLHVSEMLLLQDPHKKTTMTLSDGLDWDSSSPKLSRFVRKPEHISRL-------- 250
            .||                          .|.||:...|.....:|...:||..|.|        
plant   138 CHH--------------------------ALGDGVSILSLILASTRKTSEPEAFSTLPVPKCRES 176

  Fly   251 INH-------IIHLIICR-----WQKFIYEF---------ESLETP----DGS--------TSSD 282
            .||       .:.|::|.     |...:..|         :..:||    .|:        .|.|
plant   177 YNHRRGFSFFRLVLVVCSTVRLIWNTLVDSFLCMATIFFLKDTDTPLKGKPGAIKKFSHRIVSLD 241

  Fly   283 QVGNLSQLMSLVVIVLVNVILGYIRSRTMLKKLKRRSVSYRNEVGRFQTMRLLLNRE--LDQRNL 345
            .:..:...|.:.:   .:|:||.  :...|.:...:|....||..   ...|..||:  ||:..|
plant   242 DIKLIKNAMEMTI---NDVLLGV--TEAALTRYLHQSYDKTNEEA---GTSLTPNRQDLLDRIRL 298

  Fly   346 NWSVARNAIYKSMQPTN-------LAKALTRFLWRLNLNHVLLLPYHIYCE-----FLAFADVLI 398
                 |:.|..:::||.       :||. ::..|. |...|:|.|:.|..:     :|:....:|
plant   299 -----RSLIVVNLRPTGSQSIADMMAKG-SKCRWG-NYISVILFPFTIALQSDPLVYLSNVKSMI 356

  Fly   399 KGKTSHTSTYCARLHLYVPLLLYAQLEFF--------------KIIWELFQAPRNIYEVLFEQPT 449
            ..|.:...||          ::|...||.              ||:........|:     ..||
plant   357 DRKKNSLITY----------IIYTFSEFVIKAFGINVAVAFQRKIMLNTTMCISNL-----PGPT 406

  Fly   450 KELNILHKKSYAGRKIVSFSRSING 474
            :|:      |:.|..|..|:.||.|
plant   407 EEV------SFHGHPIAYFAPSIYG 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33120NP_788073.1 Condensation 85..>199 CDD:305010 18/69 (26%)
AT5G22490NP_197641.1 Condensation 12..>147 CDD:305010 21/99 (21%)
Condensation <110..258 CDD:305010 30/176 (17%)
DUF1298 326..469 CDD:284411 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D828506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31650
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.