DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33120 and AT5G12420

DIOPT Version :9

Sequence 1:NP_788073.1 Gene:CG33120 / 326260 FlyBaseID:FBgn0053120 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_568275.1 Gene:AT5G12420 / 831117 AraportID:AT5G12420 Length:480 Species:Arabidopsis thaliana


Alignment Length:430 Identity:85/430 - (19%)
Similarity:147/430 - (34%) Gaps:132/430 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 WVNDSSGFNINNHVLLSTHKYRGRPV---------SESNIQEYVSELATKYIPSDLPQWQVIVIP 180
            |:  .:..|:.:||::        |.         .:|.|.:|:|.|....:....|.|.:.::.
plant    65 WI--ETEVNVEDHVIV--------PYIDAEEIGEGGQSFIDDYMSRLTMIPLDRSRPLWDIHILN 119

  Fly   181 NSDSTQPYYILIKLHH----------LIIAEEEDLHVSEMLLLQDPHKKTTMTLSDGL---DWDS 232
            ...|.......|:.||          |::|........:|.....|..|...|:|..|   .|  
plant   120 VKTSEAEAVGFIRSHHSLGDGMSLISLMLACTHKTSDPDMFSNAIPSMKRRATMSHSLKTKGW-- 182

  Fly   233 SSPKLSRFVRKPEHIS---RLI-NHIIHLII----------------------CRWQKFIYEFES 271
                   |:|....|.   ||: |..|.:::                      ...::|.:...|
plant   183 -------FLRSIFTIGSTMRLLWNTTIDMLLLLATVLFLKDTKTPLKAGADVRSNPKRFYHRIIS 240

  Fly   272 LETPDGSTSSDQVGNLSQLMSLVVIVLVNVILGYIRSRTMLKKLKRRSVSYRNEVGRFQTMRLLL 336
            |         |.:..:...|::.    :|.:|..|...::...|.|:..:.:.|.|...:.|   
plant   241 L---------DDIKLIKNAMNMT----INDVLFGITQASLSHYLNRQYGTKKEEDGALTSYR--- 289

  Fly   337 NRELDQRNLNWSVARNAIYKS---MQPTNLAKAL---TRFLWRLNLNHVLLLPYHIYCEFLAFAD 395
            |...|  .:.:.||.....:|   .:|  ||..:   ::..|. |....:.||:.|..:    .|
plant   290 NNLPD--GIRFRVACTVNLRSDIGFKP--LADMMVKDSKCRWG-NYFSFIFLPFTIGLQ----TD 345

  Fly   396 VLIKGKTSHTSTYCARLHLYVPLLLY----AQLEFF--KIIWELFQAP-RN----IYEVLFEQPT 449
            .|:..|.| .|....:.|.|...|:|    ..|:.|  |...|||..| ||    :..|:  .|.
plant   346 PLVYLKMS-KSMMARKKHSYHAALVYFIIKIVLKVFGAKAAAELFDRPVRNTTTCVSNVI--GPM 407

  Fly   450 KELN--------------------ILHKKSYAGRKIVSFS 469
            :|::                    ::|..|||.:.|:|.:
plant   408 EEISFRGHPVSYIAPSSYGHSHALLIHLMSYADKMIISLA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33120NP_788073.1 Condensation 85..>199 CDD:305010 17/92 (18%)
AT5G12420NP_568275.1 acyl_WS_DGAT 6..472 CDD:274360 85/430 (20%)
DUF1298 327..471 CDD:399751 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D828506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31650
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.