DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33120 and AT2G43255

DIOPT Version :9

Sequence 1:NP_788073.1 Gene:CG33120 / 326260 FlyBaseID:FBgn0053120 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001118507.1 Gene:AT2G43255 / 818927 AraportID:AT2G43255 Length:215 Species:Arabidopsis thaliana


Alignment Length:142 Identity:31/142 - (21%)
Similarity:58/142 - (40%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 NIGGVVFLQLPLRQPDANHTKELHQIVERIRKQQIIIYLASIGQTKYSLLTSLLPHVITKIFINF 606
            |..|||...|.:|. :|:.       :|.:|:.:..|      ..|...|.:...:.:.|..:||
plant    63 NFVGVVIFPLWVRS-EADP-------LEYVRRARATI------DRKILSLEAFNFYGVIKFTMNF 113

  Fly   607 FSYNFPITITE-IYG-ATAEFQAAWGQNVQDVLLFRPPQSKTCLS-------LNLH--RFGDKYR 660
            |.......::: :|. .|..:.:..|.| :|:.:|..|.|....|       .|:|  .:.:|..
plant   114 FGEKVVQAVSKRLYDHTTLTYSSVMGPN-EDISIFDHPISYVAASALTGSQVFNIHIVSYVNKII 177

  Fly   661 LAVMADTHLAPD 672
            :::..|..:.||
plant   178 ISLAVDATVNPD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33120NP_788073.1 Condensation 85..>199 CDD:305010
AT2G43255NP_001118507.1 DUF1298 61..205 CDD:284411 31/142 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D828506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.