DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33120 and AT2G38995

DIOPT Version :9

Sequence 1:NP_788073.1 Gene:CG33120 / 326260 FlyBaseID:FBgn0053120 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001189709.1 Gene:AT2G38995 / 818485 AraportID:AT2G38995 Length:487 Species:Arabidopsis thaliana


Alignment Length:283 Identity:50/283 - (17%)
Similarity:102/283 - (36%) Gaps:75/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KTGMLRFPKLRQKL-VTCWGHYAWVNDSSGFNINNHVLLSTHKYRGRPVSESNIQEYVSELATKY 166
            |...::.|:...|: :...|..:||..|  ..:.:||::....|......:..|::|.|:||...
plant    59 KNTWIKLPRFSSKVEIKKNGKASWVPVS--VRVEDHVVVPDLDYSNIENPDQFIEDYTSKLANTP 121

  Fly   167 IPSDLPQWQVIVIPNSDSTQPYYILIKLHHLIIAEEEDLHVSEMLLLQDPHKKTTMTLSDGLDWD 231
            :....|.|::.::....|......:.|.||                          :|.||:...
plant   122 MDMSRPLWELHLLNIKTSNAESLAIGKFHH--------------------------SLGDGMSLI 160

  Fly   232 SSSPKLSRFVRKPEHISRLINHIIHLIICRWQKFIYEFESLETPDGSTSSDQ----VGNLSQLMS 292
            |.....||....|:.:.                     .:..|...::|:.:    ||....::.
plant   161 SLLLASSRKTSDPDALP---------------------TTAATRKHASSNKKSWWLVGRFWFMIR 204

  Fly   293 LVVIVLVNVI-----LGYIR-SRTML-----KKLKRRSVSYRNEVGRFQTMRLLLNRELDQRNLN 346
            ::...:|.:.     |.::| ::|.|     ..::.|.|.:|  :..|..::|:.|      |::
plant   205 IIFTTVVELFKYLLTLCFMRDTKTPLMGKTGDAIRSRKVIHR--IVSFDDVKLVKN------NMD 261

  Fly   347 WSVARNAIYKSMQPTNLAKALTR 369
            ..|  |.:...|....|::.|:|
plant   262 MKV--NDVLLGMTQAGLSRYLSR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33120NP_788073.1 Condensation 85..>199 CDD:305010 21/96 (22%)
AT2G38995NP_001189709.1 Condensation 63..268 CDD:305010 45/263 (17%)
DUF1298 330..474 CDD:284411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D828506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31650
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.