DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33116 and CHPT1

DIOPT Version :9

Sequence 1:NP_788074.1 Gene:CG33116 / 326259 FlyBaseID:FBgn0053116 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_064629.2 Gene:CHPT1 / 56994 HGNCID:17852 Length:406 Species:Homo sapiens


Alignment Length:432 Identity:113/432 - (26%)
Similarity:187/432 - (43%) Gaps:92/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LTQDQINGFDNYKYSAIDTS----PLSQYVMHPFWDWLVKFFPRWFAPNLMTFLGFLFSAM-NLV 73
            |:..|:...:.::|||...|    ||..|     |.||:::.|.|.|||.:|.||...:.: .||
Human    21 LSAAQLRRLEEHRYSAAGVSLLEPPLQLY-----WTWLLQWIPLWMAPNSITLLGLAVNVVTTLV 80

  Fly    74 LLSYYDWNFDASSGEEGTTPIPSWVWLCTAINIFLAYTLDGIDGKQARRIGLSGPLGELFDHGLD 138
            |:||.         ...|...|.|.:|..|:.:|:..:||.||||||||.....|||||||||.|
Human    81 LISYC---------PTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCD 136

  Fly   139 SYTAMLIPTCLYSIFGRSRVYSVRPMRMYYVCLTVYFNFFISHWEKYNTGIL------------Y 191
            |.:.:.:.... ||..|...|   |...::......|.|:.:||:.|.:|:|            .
Human   137 SLSTVFMAVGA-SIAARLGTY---PDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIA 197

  Fly   192 LPWGYDLSMWGSTAMYLVTWWMGFERWKFELPLGSYGTLPLGNVMEAVLHVSAMANLPLV----- 251
            |...:.||.:|...|           |.:.:|           ::|..|.:     ||::     
Human   198 LVIVFVLSAFGGATM-----------WDYTIP-----------ILEIKLKI-----LPVLGFLGG 235

  Fly   252 IINVYNSYAH--------RTGRLLSFWEAVRPMWPFITYFVILLAWPY-VSPNDIMEKDPRAIFM 307
            :|...::|.|        :.|..::....:.| ...|...:||....| .|..|:.||.|....:
Human   236 VIFSCSNYFHVILHGGVGKNGSTIAGTSVLSP-GLHIGLIIILAIMIYKKSATDVFEKHPCLYIL 299

  Fly   308 LSGTIFSNVSCRLIVSQMSVTRCEAWHWQTPMFI---LSFLTSLWIPLL-ERPLLYLLLIVTTLS 368
            :.|.:|:.||.:|:|:.|  |:.|. :.|..:|:   |.||...:...: |..:|::.:::::..
Human   300 MFGCVFAKVSQKLVVAHM--TKSEL-YLQDTVFLGPGLLFLDQYFNNFIDEYVVLWMAMVISSFD 361

  Fly   369 HWQYGASVVNQMCEH-----FNRVCFTVHKRVPQEELPKKKT 405
            ...|.:::..|:..|     |...|   |:...|.::...|:
Human   362 MVIYFSALCLQISRHLHLNIFKTAC---HQAPEQVQVLSSKS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33116NP_788074.1 CDP-OH_P_transf 13..348 CDD:382018 103/367 (28%)
CHPT1NP_064629.2 CDP-OH_P_transf 25..337 CDD:294308 100/360 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D847100at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.