DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33116 and CG31697

DIOPT Version :10

Sequence 1:NP_788074.1 Gene:CG33116 / 326259 FlyBaseID:FBgn0053116 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_724209.1 Gene:CG31697 / 35243 FlyBaseID:FBgn0051697 Length:147 Species:Drosophila melanogaster


Alignment Length:59 Identity:16/59 - (27%)
Similarity:22/59 - (37%) Gaps:13/59 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 WPYVSPND-----IMEK-DP------RAIFMLSGTIFSNVSCRLIVSQ-MSVTRCEAWH 334
            |||.:..|     |.|| ||      |.|..|...:......:....| |:|.:...|:
  Fly    53 WPYFNCTDQEVQRIREKLDPVSLQNARKIISLDKGVDEKYEMKHNTPQPMTVNQIYGWY 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33116NP_788074.1 PRK10832 13..>325 CDD:469774 13/48 (27%)
CG31697NP_724209.1 None

Return to query results.
Submit another query.