DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33109 and CG16826

DIOPT Version :9

Sequence 1:NP_788677.1 Gene:CG33109 / 326258 FlyBaseID:FBgn0053109 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001285888.1 Gene:CG16826 / 34741 FlyBaseID:FBgn0032505 Length:341 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:114/232 - (49%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ITQLRNLLDNYVAKLLSDLPNTRKKKRRQGLQESLQALTGLGLSISPLLKFLTNI--KAEEEQLV 130
            |.::||:|                  :|:.|:::|..|..:...::.|...:.|:  :.:|::..
  Fly   113 IDRVRNIL------------------QREALKDALARLQTVNTVVNDLEVAVNNLNDRIDEKKQE 159

  Fly   131 SKLNVQEEWKFWAAAKVSKVQESTKGLRTAEAVSITENFNSRYGLRLRSCVGLFIWNQIRFNLDL 195
            ....:|::|..|:.|::.:|.:.|.|:...||..|.....|||...|.||:......|..|..::
  Fly   160 YFAIIQKKWYQWSDAQLERVDKLTNGVGNEEAEEIINELLSRYSGYLHSCLEELQAQQATFEQNV 224

  Fly   196 ESSLNGLQNPTEHLIDVTEGC--SSVKPKKCRRNVRRAIDGIQNAPQNLLNLRTKGNQLEDIQRQ 258
            :.::....|.|..|.|..|.|  .::....||..:..|:.|:.:||..||.|:.:|.:|..|...
  Fly   225 QEAIEKYHNATNELTDQVELCVQFNLSFLSCRNGINEALRGLDSAPAELLTLKLQGIRLLAIGLN 289

  Fly   259 SNQCVDKTVKEYTEERVEVERQLDDIIEDYLESETFT 295
            ::.||.:|:.|:..|:..|||:||:||.:|.|.:|.|
  Fly   290 ASGCVGQTLAEHELEKPSVERKLDEIIAEYQEQQTST 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33109NP_788677.1 PX_domain <23..90 CDD:295365 4/21 (19%)
CG16826NP_001285888.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020263
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.